Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2030 [new locus tag: SA_RS11675 ]
- pan locus tag?: SAUPAN005684000
- symbol: rpmD
- pan gene symbol?: rpmD
- synonym:
- product: 50S ribosomal protein L30
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2030 [new locus tag: SA_RS11675 ]
- symbol: rpmD
- product: 50S ribosomal protein L30
- replicon: chromosome
- strand: -
- coordinates: 2299900..2300079
- length: 180
- essential: yes DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124950 NCBI
- RefSeq: NP_375345 NCBI
- BioCyc: see SA_RS11675
- MicrobesOnline: 104371 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGCTAAATTACAAATTACCCTCACTCGTAGTGTTATTGGTCGTCCTGAAACACAACGT
AAAACTGTTGAAGCTTTAGGTCTTAAAAAGACTAACAGTTCAGTAGTTGTTGAAGATAAC
CCTGCTATTCGTGGGCAAATCAACAAAGTTAAGCACTTAGTAACAGTAGAAGAAAAATAA60
120
180
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SA2030 [new locus tag: SA_RS11675 ]
- symbol: RpmD
- description: 50S ribosomal protein L30
- length: 59
- theoretical pI: 10.9014
- theoretical MW: 6553.63
- GRAVY: -0.4
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL30 (TIGR01308; HMM-score: 96)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL30 (TIGR01309; HMM-score: 22.1)
- TheSEED :
- LSU ribosomal protein L30p (L7e)
- PFAM: no clan defined Ribosomal_L30; Ribosomal protein L30p/L7e (PF00327; HMM-score: 83.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8898
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0.0032
- Extracellular Score: 0.1065
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008552
- TAT(Tat/SPI): 0.00171
- LIPO(Sec/SPII): 0.001474
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: adk < secY < rplO < rpmD < rpsE < rplR < rplF < rpsH < rpsN < rplE < rplX < rplN < rpsQ < rpmC < rplP < rpsC < rplV < rpsS < rplB < rplW < rplD < rplC < rpsJ
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]