Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2029 [new locus tag: SA_RS11670 ]
- pan locus tag?: SAUPAN005683000
- symbol: rplO
- pan gene symbol?: rplO
- synonym:
- product: 50S ribosomal protein L15
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2029 [new locus tag: SA_RS11670 ]
- symbol: rplO
- product: 50S ribosomal protein L15
- replicon: chromosome
- strand: -
- coordinates: 2299443..2299883
- length: 441
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124949 NCBI
- RefSeq: NP_375344 NCBI
- BioCyc:
- MicrobesOnline: 104370 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAATTACATGAGTTAAAACCGGCAGAAGGTTCACGTAAAGAACGCAATCGTGTTGGA
CGTGGTGTTGCGACAGGTAATGGTAAAACAAGTGGTCGCGGACACAAAGGTCAAAAAGCT
CGTTCAGGCGGTGGTGTAAGACCAGGATTTGAAGGTGGTCAATTACCATTATTCCGTCGT
TTACCAAAACGTGGTTTTACTAACATAAATCGTAAAGAATATGCTATTGTTAACTTAGAC
CAACTTAATAAATTTGAAGATGGTACTGAAGTAACTCCAGCTTTATTAGTAGAATCTGGT
GTTGTTAAGAATGAAAAATCTGGTATCAAAATACTAGGTAATGGTTCACTTGATAAGAAA
TTGACAGTGAAAGCTCATAAATTCTCAGCTTCAGCAGCAGAAGCTATTGATGCTAAAGGT
GGAGCACACGAGGTGATCTAA60
120
180
240
300
360
420
441
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SA2029 [new locus tag: SA_RS11670 ]
- symbol: RplO
- description: 50S ribosomal protein L15
- length: 146
- theoretical pI: 11.0348
- theoretical MW: 15596.7
- GRAVY: -0.658904
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL15 (TIGR01071; HMM-score: 182.6)
- TheSEED: and 1 more
- PFAM: Ribos_L15p_L18e (CL0588) Ribosomal_L27A; Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A (PF00828; HMM-score: 130.3)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
SA0905 (atl) autolysin, N-acetylmuramyl-L-alanine amidase and endo-b-N-acetylglucosaminidas [2] (data from MRSA252) SA2057 (fmhB) FmhB protein [2] (data from MRSA252) SA0505 (fus) elongation factor G [2] (data from MRSA252) SA1305 (hu) DNA-binding protein II [2] (data from MRSA252) SA1112 (infB) translation initiation factor IF-2 [2] (data from MRSA252) SA1504 (infC) translation initiation factor IF-3 [2] (data from MRSA252) SA0038 (mecA) penicillin binding protein 2 prime [2] (data from MRSA252) SA1189 (parC) DNA topoisomerase IV subunit A [2] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [2] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [2] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [2] (data from MRSA252) SA1117 (pnpA) polynucleotide phosphorylase [2] (data from MRSA252) SA1520 (pykA) pyruvate kinase [2] (data from MRSA252) SA1460 (relA) GTP pyrophosphokinase [2] (data from MRSA252) SA0735 (rnr) ribonuclease R [2] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [2] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [2] (data from MRSA252) SA2047 (rplC) 50S ribosomal protein L3 [2] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [2] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [2] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [2] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA2017 (rplM) 50S ribosomal protein L13 [2] (data from MRSA252) SA2022 (rplQ) 50S ribosomal protein L17 [2] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [2] (data from MRSA252) SA1502 (rplT) 50S ribosomal protein L20 [2] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [2] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [2] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [2] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [2] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [2] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [2] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [2] (data from MRSA252) SA0182 hypothetical protein [2] (data from MRSA252) SA0295 hypothetical protein [2] (data from MRSA252) SA0637 hypothetical protein [2] (data from MRSA252) SA0802 hypothetical protein [2] (data from MRSA252) SA0941 hypothetical protein [2] (data from MRSA252) SA1118 hypothetical protein [2] (data from MRSA252) SA1443 hypothetical protein [2] (data from MRSA252) SA1528 hypothetical protein [2] (data from MRSA252) SA1532 hypothetical protein [2] (data from MRSA252) SA1885 hypothetical protein [2] (data from MRSA252) SA2123 hypothetical protein [2] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.038518
- TAT(Tat/SPI): 0.049685
- LIPO(Sec/SPII): 0.011965
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRRLPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESGVVKNEKSGIKILGNGSLDKKLTVKAHKFSASAAEAIDAKGGAHEVI
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: adk < secY < rplO < rpmD < rpsE < rplR < rplF < rpsH < rpsN < rplE < rplX < rplN < rpsQ < rpmC < rplP < rpsC < rplV < rpsS < rplB < rplW < rplD < rplC < rpsJ
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑
R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43
Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]