Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2017 [new locus tag: SA_RS11605 ]
- pan locus tag?: SAUPAN005667000
- symbol: rplM
- pan gene symbol?: rplM
- synonym:
- product: 50S ribosomal protein L13
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2017 [new locus tag: SA_RS11605 ]
- symbol: rplM
- product: 50S ribosomal protein L13
- replicon: chromosome
- strand: -
- coordinates: 2290241..2290678
- length: 438
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124936 NCBI
- RefSeq: NP_375331 NCBI
- BioCyc: see SA_RS11605
- MicrobesOnline: 104357 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGCGTCAAACATTTATGGCAAATGAATCAAACATTGAGCGCAAATGGTATGTTATCGAT
GCTGAAGGCCAAACATTAGGTCGTTTATCATCAGAAGTAGCATCTATCTTACGCGGTAAA
AATAAAGTAACTTACACACCACACGTTGATACTGGTGATTATGTAATCGTTATTAATGCA
TCAAAAATCGAATTTACTGGTAACAAAGAAACTGACAAAGTTTACTACCGTCACTCAAAT
CATCCAGGTGGTATCAAATCAATCACTGCTGGTGAATTAAGAAGAACTAACCCAGAACGT
TTAATTGAAAACTCAATTAAAGGTATGTTACCAAGCACTCGTTTAGGCGAAAAACAAGGT
AAAAAATTATTTGTATATGGTGGCGCTGAACATCCACACGCTGCACAACAACCAGAAAAC
TACGAATTACGTGGTTAA60
120
180
240
300
360
420
438
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SA2017 [new locus tag: SA_RS11605 ]
- symbol: RplM
- description: 50S ribosomal protein L13
- length: 145
- theoretical pI: 9.74811
- theoretical MW: 16333.3
- GRAVY: -0.762069
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL13 (TIGR01066; HMM-score: 201.9)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL13 (TIGR01077; HMM-score: 49.1)
- TheSEED :
- LSU ribosomal protein L13p (L13Ae)
- PFAM: no clan defined Ribosomal_L13; Ribosomal protein L13 (PF00572; HMM-score: 181.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009239
- TAT(Tat/SPI): 0.000698
- LIPO(Sec/SPII): 0.001378
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYELRG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA0033 (aadD) kanamycin nucleotidyltransferase [2] (data from MRSA252) SA1533 (ackA) acetate kinase [2] (data from MRSA252) SA1075 (acpP) acyl carrier protein [2] (data from MRSA252) SA0562 (adh1) alcohol dehydrogenase [2] (data from MRSA252) SA0366 (ahpC) alkyl hydroperoxide reductase [2] (data from MRSA252) SA2428 (arcA) arginine deiminase [2] (data from MRSA252) SA2427 (arcB) ornithine carbamoyltransferase [2] (data from MRSA252) SA1287 (asnC) asparaginyl-tRNA synthetase [2] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [2] (data from MRSA252) SA0723 (clpP) ATP-dependent Clp protease proteolytic subunit [2] (data from MRSA252) SA0471 (cysK) hypothetical protein [2] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [2] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [2] (data from MRSA252) SA0545 (eutD) phosphotransacetylase [2] (data from MRSA252) SA1074 (fabG) 3-oxoacyl-ACP reductase [2] (data from MRSA252) SA0869 (fabI) enoyl-ACP reductase [2] (data from MRSA252) SA1901 (fabZ) (3R)-hydroxymyristoyl-ACP dehydratase [2] (data from MRSA252) SA1927 (fbaA) fructose-bisphosphate aldolase [2] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [2] (data from MRSA252) SA0915 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [2] (data from MRSA252) SA1102 (frr) ribosome recycling factor [2] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [2] (data from MRSA252) SA0505 (fus) elongation factor G [2] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [2] (data from MRSA252) SA1715 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [2] (data from MRSA252) SA1394 (glyS) glycyl-tRNA synthetase [2] (data from MRSA252) SA1342 (gnd) 6-phosphogluconate dehydrogenase [2] (data from MRSA252) SA1837 (groES) co-chaperonin GroES [2] (data from MRSA252) SA1410 (grpE) heat shock protein GrpE [2] (data from MRSA252) SA0375 (guaB) inositol-monophosphate dehydrogenase [2] (data from MRSA252) SA1305 (hu) DNA-binding protein II [2] (data from MRSA252) SA1112 (infB) translation initiation factor IF-2 [2] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [2] (data from MRSA252) SA1926 (murZ) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [2] (data from MRSA252) SA1109 (nusA) transcription elongation factor NusA [2] (data from MRSA252) SA1244 (odhB) dihydrolipoamide succinyltransferase [2] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [2] (data from MRSA252) SA0944 (pdhB) pyruvate dehydrogenase E1 component subunit beta [2] (data from MRSA252) SA0945 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 subunit [2] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [2] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [2] (data from MRSA252) SA0823 (pgi) glucose-6-phosphate isomerase [2] (data from MRSA252) SA0728 (pgk) phosphoglycerate kinase [2] (data from MRSA252) SA1117 (pnpA) polynucleotide phosphorylase [2] (data from MRSA252) SA1106 (proS) prolyl-tRNA synthetase [2] (data from MRSA252) SA1520 (pykA) pyruvate kinase [2] (data from MRSA252) SA2341 (rocA) 1-pyrroline-5-carboxylate dehydrogenase [2] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [2] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [2] (data from MRSA252) SA2047 (rplC) 50S ribosomal protein L3 [2] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [2] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [2] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [2] (data from MRSA252) SA0014 (rplI) 50S ribosomal protein L9 [2] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [2] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [2] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA2037 (rplN) 50S ribosomal protein L14 [2] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [2] (data from MRSA252) SA2022 (rplQ) 50S ribosomal protein L17 [2] (data from MRSA252) SA2032 (rplR) 50S ribosomal protein L18 [2] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [2] (data from MRSA252) SA1502 (rplT) 50S ribosomal protein L20 [2] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [2] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [2] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [2] (data from MRSA252) SA2036 (rplX) 50S ribosomal protein L24 [2] (data from MRSA252) SA0459 (rplY) 50S ribosomal protein L25 [2] (data from MRSA252) SA1067 (rpmB) 50S ribosomal protein L28 [2] (data from MRSA252) SA2030 (rpmD) 50S ribosomal protein L30 [2] (data from MRSA252) SA1922 (rpmE2) 50S ribosomal protein L31 [2] (data from MRSA252) SA1503 (rpmI) 50S ribosomal protein L35 [2] (data from MRSA252) SA0500 (rpoB) DNA-directed RNA polymerase subunit beta [2] (data from MRSA252) SA1308 (rpsA) 30S ribosomal protein S1 [2] (data from MRSA252) SA1099 (rpsB) 30S ribosomal protein S2 [2] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [2] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [2] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [2] (data from MRSA252) SA0352 (rpsF) 30S ribosomal protein S6 [2] (data from MRSA252) SA0504 (rpsG) 30S ribosomal protein S7 [2] (data from MRSA252) SA2034 (rpsH) 30S ribosomal protein S8 [2] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [2] (data from MRSA252) SA2048 (rpsJ) 30S ribosomal protein S10 [2] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [2] (data from MRSA252) SA0503 (rpsL) 30S ribosomal protein S12 [2] (data from MRSA252) SA2025 (rpsM) 30S ribosomal protein S13 [2] (data from MRSA252) SA1116 (rpsO) 30S ribosomal protein S15 [2] (data from MRSA252) SA1081 (rpsP) 30S ribosomal protein S16 [2] (data from MRSA252) SA0354 (rpsR) 30S ribosomal protein S18 [2] (data from MRSA252) SA2043 (rpsS) 30S ribosomal protein S19 [2] (data from MRSA252) SA1414 (rpsT) 30S ribosomal protein S20 [2] (data from MRSA252) SA1382 (sodA) superoxide dismutase SodA [2] (data from MRSA252) SA0107 (spa) immunoglobulin G binding protein A [2] (data from MRSA252) SA0456 (spoVG) regulatory protein SpoVG [2] (data from MRSA252) SA1245 (sucA) 2-oxoglutarate dehydrogenase E1 [2] (data from MRSA252) SA1088 (sucC) succinyl-CoA synthetase subunit beta [2] (data from MRSA252) SA1089 (sucD) succinyl-CoA synthetase subunit alpha [2] (data from MRSA252) SA1177 (tkt) transketolase [2] (data from MRSA252) SA0729 (tpiA) triosephosphate isomerase [2] (data from MRSA252) SA0992 (trxA) thioredoxin [2] (data from MRSA252) SA1100 (tsf) elongation factor Ts [2] (data from MRSA252) SA0506 (tuf) elongation factor Tu [2] (data from MRSA252) SA0351 GTP-dependent nucleic acid-binding protein EngD [2] (data from MRSA252) SA0372 hypothetical protein [2] (data from MRSA252) SA0466 hypothetical protein [2] (data from MRSA252) SA0477 pyridoxal biosynthesis lyase PdxS [2] (data from MRSA252) SA0537 phosphomethylpyrimidine kinase [2] (data from MRSA252) SA0587 hypothetical protein [2] (data from MRSA252) SA0627 hypothetical protein [2] (data from MRSA252) SA0641 hypothetical protein [2] (data from MRSA252) SA0707 hypothetical protein [2] (data from MRSA252) SA0758 hypothetical protein [2] (data from MRSA252) SA0802 hypothetical protein [2] (data from MRSA252) SA0859 hypothetical protein [2] (data from MRSA252) SA0873 hypothetical protein [2] (data from MRSA252) SA1255 PTS system glucose-specific transporter subunit enzyme II A [2] (data from MRSA252) SA1256 methionine sulfoxide reductase B [2] (data from MRSA252) SA1443 hypothetical protein [2] (data from MRSA252) SA1528 hypothetical protein [2] (data from MRSA252) SA1692 hypothetical protein [2] (data from MRSA252) SA1709 hypothetical protein [2] (data from MRSA252) SA1924 hypothetical protein [2] (data from MRSA252) SA2395 L-lactate dehydrogenase [2] (data from MRSA252) SA2399 fructose-1,6-bisphosphate aldolase [2] (data from MRSA252) SAS074 hypothetical protein [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: L13 leader (transcription termination) regulon
L13 leader (RNA) important in Ribosome biogenesis; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.000 2.001 2.002 2.003 2.004 2.005 2.006 2.007 2.008 2.009 2.010 2.011 2.012 2.013 2.014 2.015 2.016 2.017 2.018 2.019 2.020 2.021 2.022 2.023 2.024 2.025 2.026 2.027 2.028 2.029 2.030 2.031 2.032 2.033 2.034 2.035 2.036 2.037 2.038 2.039 2.040 2.041 2.042 2.043 2.044 2.045 2.046 2.047 2.048 2.049 2.050 2.051 2.052 2.053 2.054 2.055 2.056 2.057 2.058 2.059 2.060 2.061 2.062 2.063 2.064 2.065 2.066 2.067 2.068 2.069 2.070 2.071 2.072 2.073 2.074 2.075 2.076 2.077 2.078 2.079 2.080 2.081 2.082 2.083 2.084 2.085 2.086 2.087 2.088 2.089 2.090 2.091 2.092 2.093 2.094 2.095 2.096 2.097 2.098 2.099 2.100 2.101 2.102 2.103 2.104 2.105 2.106 2.107 2.108 2.109 2.110 2.111 2.112 2.113 2.114 2.115 2.116 2.117 2.118 2.119 2.120 2.121 2.122 2.123 2.124 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)