Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0873 [new locus tag: SA_RS04935 ]
- pan locus tag?: SAUPAN003192000
- symbol: SA0873
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0873 [new locus tag: SA_RS04935 ]
- symbol: SA0873
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 989093..989602
- length: 510
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123690 NCBI
- RefSeq: NP_374136 NCBI
- BioCyc: see SA_RS04935
- MicrobesOnline: 103162 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGATTTTAGGATTAGCATTAATTCCATCAAAGTCATTTCAAGAAGCGGTGGATTCTTAC
CGTAAAAGATATGATAAACAGTATTCACGAATTAAACCACATGTGACAATTAAAGCGCCA
TTTGAAATTGAAGATGGTGATTTAGATTCTGTCATTGAACAGGTTAGAGCTCGTATTAAT
GGTATACCAGCAGTAGAAGTTCATGCTACAAAAGCTTCTAGCTTCAAACCAACGAACAAT
GTGATTTACTTTAAAGTTGCGAAGACGGACGACTTAGAAGAATTGTTTAATCGCTTTAAT
GGAGAAGATTTCTATGGAGAAGCTGAACATGTTTTTGTGCCACACTTTACAATAGCACAA
GGACTATCTAGCCAAGAATTCGAAGATATTTTTGGTCAAGTAGCATTAGCTGGGGTAGAC
CATAAAGAAATTATCGATGAATTAACTTTGTTACGTTTTGACGATGACGAAGATAAATGG
AAAGTTATTGAAACGTTTAAATTAGCTTAA60
120
180
240
300
360
420
480
510
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0873 [new locus tag: SA_RS04935 ]
- symbol: SA0873
- description: hypothetical protein
- length: 169
- theoretical pI: 4.63165
- theoretical MW: 19326.6
- GRAVY: -0.311243
⊟Function[edit | edit source]
- reaction: EC 3.1.-.-? ExPASy
- TIGRFAM: Transcription RNA processing 2'-5' RNA ligase (TIGR02258; EC 6.5.1.-; HMM-score: 15.9)and 1 moreputative phosphonate metabolism protein (TIGR03223; HMM-score: 12.2)
- TheSEED :
- 2H phosphoesterase superfamily protein Bsu1186 (yjcG)
- PFAM: 2H (CL0247) 2_5_RNA_ligase2; 2'-5' RNA ligase superfamily (PF13563; HMM-score: 78.8)and 5 moreLigT_PEase; LigT like Phosphoesterase (PF02834; HMM-score: 48.5)CPDase; Cyclic phosphodiesterase-like protein (PF07823; HMM-score: 18.7)no clan defined DUF6707; Family of unknown function (DUF6707) (PF20453; HMM-score: 13.8)E-set (CL0159) TarS_C1; TarS beta-glycosyltransferase C-terminal domain 1 (PF18674; HMM-score: 13.3)TPR (CL0020) Vps16_C; Vps16, C-terminal region (PF04840; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9836
- Cytoplasmic Membrane Score: 0.0087
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0075
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.83
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012487
- TAT(Tat/SPI): 0.000962
- LIPO(Sec/SPII): 0.001343
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIEDGDLDSVIEQVRARINGIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGEDFYGEAEHVFVPHFTIAQGLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA1984 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [1] (data from MRSA252) SA1244 (odhB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA0945 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 subunit [1] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SA1520 (pykA) pyruvate kinase [1] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SA0506 (tuf) elongation factor Tu [1] (data from MRSA252) SA0760 glycine cleavage system protein H [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: CcpA regulon
CcpA (TF) important in Carbon catabolism; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J Microbiol Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)