Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2016 [new locus tag: SA_RS11600 ]
- pan locus tag?: SAUPAN005634000
- symbol: rpsI
- pan gene symbol?: rpsI
- synonym:
- product: 30S ribosomal protein S9
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2016 [new locus tag: SA_RS11600 ]
- symbol: rpsI
- product: 30S ribosomal protein S9
- replicon: chromosome
- strand: -
- coordinates: 2289829..2290221
- length: 393
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124935 NCBI
- RefSeq: NP_375330 NCBI
- BioCyc: see SA_RS11600
- MicrobesOnline: 104356 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361TTGGCACAAGTTGAATATAGAGGCACAGGCCGTCGTAAAAACTCAGTAGCACGTGTACGT
TTAGTACCAGGTGAAGGTAACATCACAGTTAATAACCGTGACGTACGCGAATACTTACCA
TTCGAATCATTAATTTTAGACTTAAACCAACCATTTGATGTAACTGAAACTAAAGGTAAC
TATGATGTTTTAGTTAACGTTCATGGTGGTGGTTTCACTGGACAAGCTCAAGCTATCCGT
CACGGAATCGCTCGTGCATTATTAGAAGCAGATCCTGAATACAGAGGTTCTTTAAAACGC
GCTGGATTACTTACTCGTGACCCACGTATGAAAGAACGTAAAAAACCAGGTCTTAAAGCA
GCTCGTCGTTCACCTCAATTCTCAAAACGTTAA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2016 [new locus tag: SA_RS11600 ]
- symbol: RpsI
- description: 30S ribosomal protein S9
- length: 130
- theoretical pI: 11.1618
- theoretical MW: 14615.6
- GRAVY: -0.740769
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS9 (TIGR03627; HMM-score: 70.3)
- TheSEED :
- SSU ribosomal protein S9p (S16e)
- PFAM: S5 (CL0329) Ribosomal_S9; Ribosomal protein S9/S16 (PF00380; HMM-score: 166.4)and 1 moreAB_hydrolase (CL0028) BD-FAE; BD-FAE (PF20434; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8439
- Cytoplasmic Membrane Score: 0.0076
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.1474
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006049
- TAT(Tat/SPI): 0.000235
- LIPO(Sec/SPII): 0.000509
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGLKAARRSPQFSKR
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA0731 (eno) phosphopyruvate hydratase [2] (data from MRSA252) SA1305 (hu) DNA-binding protein II [2] (data from MRSA252) SA1189 (parC) DNA topoisomerase IV subunit A [2] (data from MRSA252) SA1929 (pyrG) CTP synthetase [2] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [2] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [2] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [2] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [2] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [2] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [2] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [2] (data from MRSA252) SA0498 (rplL) 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA2029 (rplO) 50S ribosomal protein L15 [2] (data from MRSA252) SA2040 (rplP) 50S ribosomal protein L16 [2] (data from MRSA252) SA2022 (rplQ) 50S ribosomal protein L17 [2] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [2] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [2] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [2] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [2] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [2] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [2] (data from MRSA252) SA0352 (rpsF) 30S ribosomal protein S6 [2] (data from MRSA252) SA0504 (rpsG) 30S ribosomal protein S7 [2] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [2] (data from MRSA252) SA2025 (rpsM) 30S ribosomal protein S13 [2] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [2] (data from MRSA252) SA0295 hypothetical protein [2] (data from MRSA252) SA0940 hypothetical protein [2] (data from MRSA252) SA1528 hypothetical protein [2] (data from MRSA252) SA2123 hypothetical protein [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: L13 leader (transcription termination) regulon
L13 leader (RNA) important in Ribosome biogenesis; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)