Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS11600 [old locus tag: SA2016 ]
- pan locus tag?: SAUPAN005634000
- symbol: SA_RS11600
- pan gene symbol?: rpsI
- synonym:
- product: 30S ribosomal protein S9
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS11600 [old locus tag: SA2016 ]
- symbol: SA_RS11600
- product: 30S ribosomal protein S9
- replicon: chromosome
- strand: -
- coordinates: 2289829..2290221
- length: 393
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361TTGGCACAAGTTGAATATAGAGGCACAGGCCGTCGTAAAAACTCAGTAGCACGTGTACGT
TTAGTACCAGGTGAAGGTAACATCACAGTTAATAACCGTGACGTACGCGAATACTTACCA
TTCGAATCATTAATTTTAGACTTAAACCAACCATTTGATGTAACTGAAACTAAAGGTAAC
TATGATGTTTTAGTTAACGTTCATGGTGGTGGTTTCACTGGACAAGCTCAAGCTATCCGT
CACGGAATCGCTCGTGCATTATTAGAAGCAGATCCTGAATACAGAGGTTCTTTAAAACGC
GCTGGATTACTTACTCGTGACCCACGTATGAAAGAACGTAAAAAACCAGGTCTTAAAGCA
GCTCGTCGTTCACCTCAATTCTCAAAACGTTAA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS11600 [old locus tag: SA2016 ]
- symbol: SA_RS11600
- description: 30S ribosomal protein S9
- length: 130
- theoretical pI: 11.1618
- theoretical MW: 14615.6
- GRAVY: -0.740769
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS9 (TIGR03627; HMM-score: 70.3)
- TheSEED:
- PFAM: S5 (CL0329) Ribosomal_S9; Ribosomal protein S9/S16 (PF00380; HMM-score: 155.4)and 1 moreno clan defined DUF2135; Uncharacterized protein conserved in bacteria (DUF2135) (PF09906; HMM-score: 12.8)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
SA_RS01710 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) SA_RS02015 30S ribosomal protein S6 [1] (data from MRSA252) SA_RS02905 50S ribosomal protein L11 [1] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [1] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [1] (data from MRSA252) SA_RS02920 50S ribosomal protein L7/L12 [1] (data from MRSA252) SA_RS02950 30S ribosomal protein S7 [1] (data from MRSA252) SA_RS04160 enolase [1] (data from MRSA252) SA_RS05325 ribonuclease J 1 [1] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [1] (data from MRSA252) SA_RS06755 DNA topoisomerase 4 subunit A [1] (data from MRSA252) SA_RS07385 DNA-binding protein HU [1] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [1] (data from MRSA252) SA_RS08600 universal stress protein [1] (data from MRSA252) SA_RS08675 30S ribosomal protein S4 [1] (data from MRSA252) SA_RS11085 CTP synthetase [1] (data from MRSA252) SA_RS11630 50S ribosomal protein L17 [1] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [1] (data from MRSA252) SA_RS11645 30S ribosomal protein S13 [1] (data from MRSA252) SA_RS11670 50S ribosomal protein L15 [1] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [1] (data from MRSA252) SA_RS11690 50S ribosomal protein L6 [1] (data from MRSA252) SA_RS11705 50S ribosomal protein L5 [1] (data from MRSA252) SA_RS11720 30S ribosomal protein S17 [1] (data from MRSA252) SA_RS11730 50S ribosomal protein L16 [1] (data from MRSA252) SA_RS11740 50S ribosomal protein L22 [1] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [1] (data from MRSA252) SA_RS11755 50S ribosomal protein L23 [1] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [1] (data from MRSA252) SA_RS12200 LysR family transcriptional regulator [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006049
- TAT(Tat/SPI): 0.000235
- LIPO(Sec/SPII): 0.000509
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGLKAARRSPQFSKR
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]