Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS02920 [old locus tag: SA0498 ]
- pan locus tag?: SAUPAN002311000
- symbol: SA_RS02920
- pan gene symbol?: rplL
- synonym:
- product: 50S ribosomal protein L7/L12
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS02920 [old locus tag: SA0498 ]
- symbol: SA_RS02920
- product: 50S ribosomal protein L7/L12
- replicon: chromosome
- strand: +
- coordinates: 578254..578622
- length: 369
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGCTAATCATGAACAAATCATTGAAGCGATTAAAGAAATGTCAGTATTAGAATTAAAC
GACTTAGTAAAAGCAATTGAAGAAGAATTTGGTGTAACTGCAGCTGCTCCAGTAGCAGTA
GCAGGTGCAGCTGGTGGCGCTGACGCTGCAGCAGAAAAAACTGAATTTGACGTTGAGTTA
ACTTCAGCTGGTTCATCTAAAATCAAAGTTGTTAAAGCTGTTAAAGAAGCAACTGGTTTA
GGATTAAAAGATGCTAAAGAATTAGTAGACGGAGCTCCTAAAGTAATCAAAGAAGCTTTA
CCTAAAGAAGAAGCTGAAAAACTTAAAGAACAATTAGAAGAAGTTGGAGCTACTGTAGAA
TTAAAATAA60
120
180
240
300
360
369
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS02920 [old locus tag: SA0498 ]
- symbol: SA_RS02920
- description: 50S ribosomal protein L7/L12
- length: 122
- theoretical pI: 4.32374
- theoretical MW: 12711.5
- GRAVY: -0.0483607
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL12 (TIGR00855; HMM-score: 158.6)
- TheSEED: see SA0498
- PFAM: no clan defined Ribosomal_L12; Ribosomal protein L7/L12 C-terminal domain (PF00542; HMM-score: 103.3)and 6 moreRibosomal_L12_N; Ribosomal protein L7/L12 dimerisation domain (PF16320; HMM-score: 75.9)IHF-likeDNA-bdg (CL0548) Bac_DNA_binding; Bacterial DNA-binding protein (PF00216; HMM-score: 15.3)no clan defined DUF2267; Uncharacterized conserved protein (DUF2267) (PF10025; HMM-score: 14.2)PP2C_C; Protein serine/threonine phosphatase 2C, C-terminal domain (PF07830; HMM-score: 13.3)PTS_IIA; PTS system, Lactose/Cellobiose specific IIA subunit (PF02255; HMM-score: 12.5)HTH (CL0123) HTH_33; Winged helix-turn helix (PF13592; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.057639
- TAT(Tat/SPI): 0.076736
- LIPO(Sec/SPII): 0.001562
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA_RS11130 (deoA) pyrimidine-nucleoside phosphorylase [2] (data from MRSA252) SA_RS00690 immunoglobulin G-binding protein A [2] (data from MRSA252) SA_RS01275 formate acetyltransferase [2] (data from MRSA252) SA_RS01710 5'-nucleotidase, lipoprotein e(P4) family [2] (data from MRSA252) SA_RS02015 30S ribosomal protein S6 [2] (data from MRSA252) SA_RS02095 alkyl hydroperoxide reductase subunit C [2] (data from MRSA252) SA_RS02145 IMP dehydrogenase [2] (data from MRSA252) SA_RS02710 cysteine synthase [2] (data from MRSA252) SA_RS02905 50S ribosomal protein L11 [2] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [2] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [2] (data from MRSA252) SA_RS02930 DNA-directed RNA polymerase subunit beta [2] (data from MRSA252) SA_RS02945 30S ribosomal protein S12 [2] (data from MRSA252) SA_RS02950 30S ribosomal protein S7 [2] (data from MRSA252) SA_RS02955 elongation factor G [2] (data from MRSA252) SA_RS02960 elongation factor Tu [2] (data from MRSA252) SA_RS03665 MarR family transcriptional regulator [2] (data from MRSA252) SA_RS04025 preprotein translocase subunit SecA [2] (data from MRSA252) SA_RS04140 aldehyde dehydrogenase [2] (data from MRSA252) SA_RS04145 phosphoglycerate kinase [2] (data from MRSA252) SA_RS04150 triose-phosphate isomerase [2] (data from MRSA252) SA_RS04160 enolase [2] (data from MRSA252) SA_RS04575 NADH dehydrogenase [2] (data from MRSA252) SA_RS04710 hypothetical protein [2] (data from MRSA252) SA_RS05300 phosphoenolpyruvate--protein phosphotransferase [2] (data from MRSA252) SA_RS05350 pyruvate dehydrogenase E1 component subunit alpha [2] (data from MRSA252) SA_RS05355 pyruvate dehydrogenase E1 component subunit beta [2] (data from MRSA252) SA_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [2] (data from MRSA252) SA_RS05365 dihydrolipoyl dehydrogenase [2] (data from MRSA252) SA_RS05860 cell division protein FtsZ [2] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [2] (data from MRSA252) SA_RS06225 30S ribosomal protein S2 [2] (data from MRSA252) SA_RS06235 elongation factor Ts [2] (data from MRSA252) SA_RS06320 polyribonucleotide nucleotidyltransferase [2] (data from MRSA252) SA_RS06690 transketolase [2] (data from MRSA252) SA_RS07005 cold-shock protein CspA [2] (data from MRSA252) SA_RS07060 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [2] (data from MRSA252) SA_RS07065 2-oxoglutarate dehydrogenase E1 component [2] (data from MRSA252) SA_RS07385 DNA-binding protein HU [2] (data from MRSA252) SA_RS07400 30S ribosomal protein S1 [2] (data from MRSA252) SA_RS07820 superoxide dismutase [2] (data from MRSA252) SA_RS07955 molecular chaperone DnaK [2] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [2] (data from MRSA252) SA_RS08460 50S ribosomal protein L20 [2] (data from MRSA252) SA_RS08545 isocitrate dehydrogenase (NADP(+)) [2] (data from MRSA252) SA_RS08560 pyruvate kinase [2] (data from MRSA252) SA_RS08600 universal stress protein [2] (data from MRSA252) SA_RS08625 universal stress protein UspA [2] (data from MRSA252) SA_RS08630 acetate kinase [2] (data from MRSA252) SA_RS09005 transaldolase [2] (data from MRSA252) SA_RS09050 hypothetical protein [2] (data from MRSA252) SA_RS09810 non-heme ferritin [2] (data from MRSA252) SA_RS09915 DUF2179 domain-containing protein [2] (data from MRSA252) SA_RS11380 hypothetical protein [2] (data from MRSA252) SA_RS11430 Asp23/Gls24 family envelope stress response protein [2] (data from MRSA252) SA_RS11600 30S ribosomal protein S9 [2] (data from MRSA252) SA_RS11605 50S ribosomal protein L13 [2] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [2] (data from MRSA252) SA_RS11645 30S ribosomal protein S13 [2] (data from MRSA252) SA_RS11670 50S ribosomal protein L15 [2] (data from MRSA252) SA_RS11675 50S ribosomal protein L30 [2] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [2] (data from MRSA252) SA_RS11685 50S ribosomal protein L18 [2] (data from MRSA252) SA_RS11690 50S ribosomal protein L6 [2] (data from MRSA252) SA_RS11735 30S ribosomal protein S3 [2] (data from MRSA252) SA_RS11740 50S ribosomal protein L22 [2] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [2] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [2] (data from MRSA252) SA_RS11765 50S ribosomal protein L3 [2] (data from MRSA252) SA_RS11895 molybdopterin molybdenumtransferase [2] (data from MRSA252) SA_RS12915 FMN-binding glutamate synthase family protein [2] (data from MRSA252) SA_RS13420 L-glutamate gamma-semialdehyde dehydrogenase [2] (data from MRSA252) SA_RS13705 L-lactate dehydrogenase [2] (data from MRSA252) SA_RS13730 class I fructose-bisphosphate aldolase [2] (data from MRSA252) SA_RS13735 malate:quinone oxidoreductase [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: L10 leader see SA0498
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43 2.44 2.45 2.46 2.47 2.48 2.49 2.50 2.51 2.52 2.53 2.54 2.55 2.56 2.57 2.58 2.59 2.60 2.61 2.62 2.63 2.64 2.65 2.66 2.67 2.68 2.69 2.70 2.71 2.72 2.73 2.74 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]