Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS07005 [old locus tag: SA1234 ]
- pan locus tag?: SAUPAN003817000
- symbol: SA_RS07005
- pan gene symbol?: cspA
- synonym:
- product: cold-shock protein CspA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS07005 [old locus tag: SA1234 ]
- symbol: SA_RS07005
- product: cold-shock protein CspA
- replicon: chromosome
- strand: -
- coordinates: 1408832..1409032
- length: 201
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAACAAGGTACAGTTAAATGGTTTAACGCTGAAAAAGGATTCGGCTTTATCGAAGTT
GAAGGAGAAAATGACGTATTCGTACATTTTTCAGCAATTAACCAAGATGGTTACAAATCA
TTAGAAGAAGGTCAAGCTGTTGAGTTTGAAGTAGTTGAAGGCGACCGCGGTCCACAAGCT
GCAAACGTTGTTAAACTATAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS07005 [old locus tag: SA1234 ]
- symbol: SA_RS07005
- description: cold-shock protein CspA
- length: 66
- theoretical pI: 4.22595
- theoretical MW: 7321.06
- GRAVY: -0.369697
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions cold shock domain protein CspD (TIGR02381; HMM-score: 96.5)DNA metabolism DNA replication, recombination, and repair cold shock domain protein CspD (TIGR02381; HMM-score: 96.5)and 1 moreTranscription Degradation of RNA VacB and RNase II family 3'-5' exoribonucleases (TIGR00358; EC 3.1.13.1; HMM-score: 10.1)
- TheSEED:
- PFAM: OB (CL0021) CSD; 'Cold-shock' DNA-binding domain (PF00313; HMM-score: 106.2)and 2 moreOB_RNB; Ribonuclease B OB domain (PF08206; HMM-score: 19.5)S1; S1 RNA binding domain (PF00575; HMM-score: 18.1)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
SA_RS11130 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SA_RS00690 immunoglobulin G-binding protein A [1] (data from MRSA252) SA_RS01275 formate acetyltransferase [1] (data from MRSA252) SA_RS02095 alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) SA_RS02625 stage V sporulation protein G [1] (data from MRSA252) SA_RS02710 cysteine synthase [1] (data from MRSA252) SA_RS02905 50S ribosomal protein L11 [1] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [1] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [1] (data from MRSA252) SA_RS02920 50S ribosomal protein L7/L12 [1] (data from MRSA252) SA_RS02930 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SA_RS02935 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SA_RS02955 elongation factor G [1] (data from MRSA252) SA_RS02960 elongation factor Tu [1] (data from MRSA252) SA_RS04140 aldehyde dehydrogenase [1] (data from MRSA252) SA_RS04160 enolase [1] (data from MRSA252) SA_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SA_RS05860 cell division protein FtsZ [1] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [1] (data from MRSA252) SA_RS06235 elongation factor Ts [1] (data from MRSA252) SA_RS07385 DNA-binding protein HU [1] (data from MRSA252) SA_RS07955 molecular chaperone DnaK [1] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [1] (data from MRSA252) SA_RS08435 trigger factor [1] (data from MRSA252) SA_RS08560 pyruvate kinase [1] (data from MRSA252) SA_RS08565 ATP-dependent 6-phosphofructokinase [1] (data from MRSA252) SA_RS08600 universal stress protein [1] (data from MRSA252) SA_RS08625 universal stress protein UspA [1] (data from MRSA252) SA_RS08675 30S ribosomal protein S4 [1] (data from MRSA252) SA_RS11430 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SA_RS11600 30S ribosomal protein S9 [1] (data from MRSA252) SA_RS11605 50S ribosomal protein L13 [1] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [1] (data from MRSA252) SA_RS11670 50S ribosomal protein L15 [1] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [1] (data from MRSA252) SA_RS11690 50S ribosomal protein L6 [1] (data from MRSA252) SA_RS11705 50S ribosomal protein L5 [1] (data from MRSA252) SA_RS11720 30S ribosomal protein S17 [1] (data from MRSA252) SA_RS11740 50S ribosomal protein L22 [1] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [1] (data from MRSA252) SA_RS11755 50S ribosomal protein L23 [1] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [1] (data from MRSA252) SA_RS11765 50S ribosomal protein L3 [1] (data from MRSA252) SA_RS13730 class I fructose-bisphosphate aldolase [1] (data from MRSA252) SA_RS13735 malate:quinone oxidoreductase [1] (data from MRSA252) SA_RS13920 arginine deiminase [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005783
- TAT(Tat/SPI): 0.000379
- LIPO(Sec/SPII): 0.000772
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQDGYKSLEEGQAVEFEVVEGDRGPQAANVVKL
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45
Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]