Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01403
- pan locus tag?: SAUPAN003817000
- symbol: SAOUHSC_01403
- pan gene symbol?: cspA
- synonym:
- product: cold shock protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01403
- symbol: SAOUHSC_01403
- product: cold shock protein
- replicon: chromosome
- strand: -
- coordinates: 1345917..1346117
- length: 201
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3920693 NCBI
- RefSeq: YP_499930 NCBI
- BioCyc: G1I0R-1311 BioCyc
- MicrobesOnline: 1289844 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAACAAGGTACAGTTAAATGGTTTAACGCTGAAAAAGGATTCGGCTTTATCGAAGTT
GAAGGAGAAAATGACGTATTCGTACATTTTTCAGCAATTAACCAAGATGGTTACAAATCA
TTAGAAGAAGGTCAAGCTGTTGAGTTTGAAGTAGTTGAAGGCGACCGCGGTCCACAAGCT
GCAAACGTTGTTAAACTATAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01403
- symbol: SAOUHSC_01403
- description: cold shock protein
- length: 66
- theoretical pI: 4.22595
- theoretical MW: 7321.06
- GRAVY: -0.369697
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions cold shock domain protein CspD (TIGR02381; HMM-score: 96.5)DNA metabolism DNA replication, recombination, and repair cold shock domain protein CspD (TIGR02381; HMM-score: 96.5)and 1 moreTranscription Degradation of RNA VacB and RNase II family 3'-5' exoribonucleases (TIGR00358; EC 3.1.13.1; HMM-score: 10.1)
- TheSEED:
- PFAM: OB (CL0021) CSD; 'Cold-shock' DNA-binding domain (PF00313; HMM-score: 106.2)and 2 moreOB_RNB; Ribonuclease B OB domain (PF08206; HMM-score: 19.5)S1; S1 RNA binding domain (PF00575; HMM-score: 18.1)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
SAOUHSC_01683 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SAOUHSC_00799 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SAOUHSC_00519 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SAOUHSC_02509 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SAOUHSC_02512 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SAOUHSC_02511 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SAOUHSC_02500 (rplE) 50S ribosomal protein L5 [1] (data from MRSA252) SAOUHSC_02496 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SAOUHSC_00520 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SAOUHSC_00518 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) SAOUHSC_00521 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SAOUHSC_02478 (rplM) 50S ribosomal protein L13 [1] (data from MRSA252) SAOUHSC_02492 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SAOUHSC_01211 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SAOUHSC_01757 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SAOUHSC_02507 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SAOUHSC_02510 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SAOUHSC_00524 (rpoB) DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SAOUHSC_01829 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SAOUHSC_02494 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SAOUHSC_02477 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SAOUHSC_02503 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SAOUHSC_01779 (tig) trigger factor [1] (data from MRSA252) SAOUHSC_01234 (tsf) elongation factor Ts [1] (data from MRSA252) SAOUHSC_00069 protein A [1] (data from MRSA252) SAOUHSC_00187 formate acetyltransferase [1] (data from MRSA252) SAOUHSC_00365 alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) SAOUHSC_00469 regulatory protein SpoVG [1] (data from MRSA252) SAOUHSC_00488 hypothetical protein [1] (data from MRSA252) SAOUHSC_00525 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SAOUHSC_00529 elongation factor G [1] (data from MRSA252) SAOUHSC_00530 elongation factor Tu [1] (data from MRSA252) SAOUHSC_00679 hypothetical protein [1] (data from MRSA252) SAOUHSC_00795 glyceraldehyde-3-phosphate dehydrogenase [1] (data from MRSA252) SAOUHSC_01042 branched-chain alpha-keto acid dehydrogenase subunit E2 [1] (data from MRSA252) SAOUHSC_01150 cell division protein FtsZ [1] (data from MRSA252) SAOUHSC_01490 DNA-binding protein HU [1] (data from MRSA252) SAOUHSC_01806 pyruvate kinase [1] (data from MRSA252) SAOUHSC_01807 6-phosphofructokinase [1] (data from MRSA252) SAOUHSC_01814 hypothetical protein [1] (data from MRSA252) SAOUHSC_01819 hypothetical protein [1] (data from MRSA252) SAOUHSC_02377 pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SAOUHSC_02441 alkaline shock protein 23 [1] (data from MRSA252) SAOUHSC_02486 30S ribosomal protein S11 [1] (data from MRSA252) SAOUHSC_02926 fructose-1,6-bisphosphate aldolase [1] (data from MRSA252) SAOUHSC_02927 malate:quinone oxidoreductase [1] (data from MRSA252) SAOUHSC_02969 arginine deiminase [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005783
- TAT(Tat/SPI): 0.000379
- LIPO(Sec/SPII): 0.000772
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQDGYKSLEEGQAVEFEVVEGDRGPQAANVVKL
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [2] [3]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- SAOUHSC_01403 no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46
Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑
Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑
Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑
Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Samuel Katzif, Damien Danavall, Samera Bowers, Jacqueline T Balthazar, William M Shafer
The major cold shock gene, cspA, is involved in the susceptibility of Staphylococcus aureus to an antimicrobial peptide of human cathepsin G.
Infect Immun: 2003, 71(8);4304-12
[PubMed:12874306] [WorldCat.org] [DOI] (P p)
Samuel Katzif, Eun-Hee Lee, Anthony B Law, Yih-Ling Tzeng, William M Shafer
CspA regulates pigment production in Staphylococcus aureus through a SigB-dependent mechanism.
J Bacteriol: 2005, 187(23);8181-4
[PubMed:16291691] [WorldCat.org] [DOI] (P p)