From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS02945 [old locus tag: SA0503 ]
  • pan locus tag?: SAUPAN002317000
  • symbol: SA_RS02945
  • pan gene symbol?: rpsL
  • synonym:
  • product: 30S ribosomal protein S12

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS02945 [old locus tag: SA0503 ]
  • symbol: SA_RS02945
  • product: 30S ribosomal protein S12
  • replicon: chromosome
  • strand: +
  • coordinates: 587420..587833
  • length: 414
  • essential: yes [1] DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (587420..587833) NCBI
  • BioCyc: SA_RS02945 BioCyc
  • MicrobesOnline: see SA0503

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGCCAACTATTAACCAATTAGTACGTAAACCAAGACAAAGCAAAATCAAAAAATCAGAT
    TCTCCAGCTTTAAATAAAGGTTTCAACAGTAAAAAGAAAAAATTTACTGACTTAAACTCA
    CCACAAAAACGTGGTGTATGTACTCGTGTAGGTACAATGACACCTAAAAAACCTAACTCA
    GCGTTACGTAAATATGCACGTGTGCGTTTATCAAACAACATCGAAATTAACGCATACATC
    CCTGGTATCGGACATAACTTACAAGAACACAGTGTTGTACTTGTACGTGGTGGACGTGTA
    AAAGACTTACCAGGTGTGCGTTACCATATTGTACGTGGAGCACTTGATACTTCAGGTGTT
    GACGGACGTAGACAAGGTCGTTCATTATACGGAACTAAGAAACCTAAAAACTAA
    60
    120
    180
    240
    300
    360
    414


Protein[edit | edit source]

Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SA_RS02945 [old locus tag: SA0503 ]
  • symbol: SA_RS02945
  • description: 30S ribosomal protein S12
  • length: 137
  • theoretical pI: 11.8375
  • theoretical MW: 15286.7
  • GRAVY: -0.854015

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS12 (TIGR00981; HMM-score: 221.2)
    and 2 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS12 (TIGR00982; HMM-score: 39.4)
    Genetic information processing Protein synthesis Translation factors translation initiation factor IF-1 (TIGR00008; HMM-score: 13.4)
  • TheSEED: see SA0503
  • PFAM:
    OB (CL0021) Ribosom_S12_S23; Ribosomal protein S12/S23 (PF00164; HMM-score: 119.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.6412
    • Cytoplasmic Membrane Score: 0.0508
    • Cell wall & surface Score: 0.0014
    • Extracellular Score: 0.3066
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.029192
    • TAT(Tat/SPI): 0.011807
    • LIPO(Sec/SPII): 0.005124
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA_RS11130(deoA)pyrimidine-nucleoside phosphorylase  [2] (data from MRSA252)
    SA_RS0021550S ribosomal protein L9  [2] (data from MRSA252)
    SA_RS00305bleomycin binding protein  [2] (data from MRSA252)
    SA_RS00310aminoglycoside O-nucleotidyltransferase ANT(4')-Ia  [2] (data from MRSA252)
    SA_RS00690immunoglobulin G-binding protein A  [2] (data from MRSA252)
    SA_RS017105'-nucleotidase, lipoprotein e(P4) family  [2] (data from MRSA252)
    SA_RS0201530S ribosomal protein S6  [2] (data from MRSA252)
    SA_RS0202530S ribosomal protein S18  [2] (data from MRSA252)
    SA_RS0265050S ribosomal protein L25/general stress protein Ctc  [2] (data from MRSA252)
    SA_RS02685RNA-binding protein S1  [2] (data from MRSA252)
    SA_RS0290550S ribosomal protein L11  [2] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [2] (data from MRSA252)
    SA_RS0292050S ribosomal protein L7/L12  [2] (data from MRSA252)
    SA_RS0295030S ribosomal protein S7  [2] (data from MRSA252)
    SA_RS03645hypothetical protein  [2] (data from MRSA252)
    SA_RS04120ATP-dependent Clp protease proteolytic subunit  [2] (data from MRSA252)
    SA_RS04150triose-phosphate isomerase  [2] (data from MRSA252)
    SA_RS04160enolase  [2] (data from MRSA252)
    SA_RS04680glucose-6-phosphate isomerase  [2] (data from MRSA252)
    SA_RS04865oligoendopeptidase F  [2] (data from MRSA252)
    SA_RS04935hypothetical protein  [2] (data from MRSA252)
    SA_RS05295phosphocarrier protein HPr  [2] (data from MRSA252)
    SA_RS05325ribonuclease J 1  [2] (data from MRSA252)
    SA_RS05895isoleucine--tRNA ligase  [2] (data from MRSA252)
    SA_RS0605050S ribosomal protein L28  [2] (data from MRSA252)
    SA_RS06095acyl carrier protein  [2] (data from MRSA252)
    SA_RS0612530S ribosomal protein S16  [2] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [2] (data from MRSA252)
    SA_RS06165succinyl-CoA ligase subunit beta  [2] (data from MRSA252)
    SA_RS06215GTP-sensing pleiotropic transcriptional regulator CodY  [2] (data from MRSA252)
    SA_RS0631530S ribosomal protein S15  [2] (data from MRSA252)
    SA_RS06325ribonuclease J 2  [2] (data from MRSA252)
    SA_RS06490glutamine synthetase  [2] (data from MRSA252)
    SA_RS06645catalase  [2] (data from MRSA252)
    SA_RS070652-oxoglutarate dehydrogenase E1 component  [2] (data from MRSA252)
    SA_RS0740030S ribosomal protein S1  [2] (data from MRSA252)
    SA_RS07510rRNA pseudouridine synthase  [2] (data from MRSA252)
    SA_RS07725glycine dehydrogenase  [2] (data from MRSA252)
    SA_RS07955molecular chaperone DnaK  [2] (data from MRSA252)
    SA_RS0798530S ribosomal protein S20  [2] (data from MRSA252)
    SA_RS08030RNA-binding protein  [2] (data from MRSA252)
    SA_RS08135hypothetical protein  [2] (data from MRSA252)
    SA_RS08230bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase  [2] (data from MRSA252)
    SA_RS0828550S ribosomal protein L27  [2] (data from MRSA252)
    SA_RS0829550S ribosomal protein L21  [2] (data from MRSA252)
    SA_RS0846050S ribosomal protein L20  [2] (data from MRSA252)
    SA_RS08470translation initiation factor IF-3  [2] (data from MRSA252)
    SA_RS08600universal stress protein  [2] (data from MRSA252)
    SA_RS08630acetate kinase  [2] (data from MRSA252)
    SA_RS086402-Cys peroxiredoxin  [2] (data from MRSA252)
    SA_RS0867530S ribosomal protein S4  [2] (data from MRSA252)
    SA_RS09960manganese-dependent inorganic pyrophosphatase  [2] (data from MRSA252)
    SA_RS10535molecular chaperone GroEL  [2] (data from MRSA252)
    SA_RS11145purine-nucleoside phosphorylase  [2] (data from MRSA252)
    SA_RS11150DNA starvation/stationary phase protection protein  [2] (data from MRSA252)
    SA_RS11245glutamine--fructose-6-phosphate aminotransferase  [2] (data from MRSA252)
    SA_RS11430Asp23/Gls24 family envelope stress response protein  [2] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [2] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [2] (data from MRSA252)
    SA_RS1164530S ribosomal protein S13  [2] (data from MRSA252)
    SA_RS1167050S ribosomal protein L15  [2] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [2] (data from MRSA252)
    SA_RS1169050S ribosomal protein L6  [2] (data from MRSA252)
    SA_RS1171550S ribosomal protein L14  [2] (data from MRSA252)
    SA_RS1172030S ribosomal protein S17  [2] (data from MRSA252)
    SA_RS1172550S ribosomal protein L29  [2] (data from MRSA252)
    SA_RS1173050S ribosomal protein L16  [2] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [2] (data from MRSA252)
    SA_RS1174050S ribosomal protein L22  [2] (data from MRSA252)
    SA_RS1174530S ribosomal protein S19  [2] (data from MRSA252)
    SA_RS1175050S ribosomal protein L2  [2] (data from MRSA252)
    SA_RS1175550S ribosomal protein L23  [2] (data from MRSA252)
    SA_RS1176050S ribosomal protein L4  [2] (data from MRSA252)
    SA_RS1176550S ribosomal protein L3  [2] (data from MRSA252)
    SA_RS1177030S ribosomal protein S10  [2] (data from MRSA252)
    SA_RS13735malate:quinone oxidoreductase  [2] (data from MRSA252)
    SA_RS13920arginine deiminase  [2] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol Microbiol: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] [DOI] (P p)
  2. 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43 2.44 2.45 2.46 2.47 2.48 2.49 2.50 2.51 2.52 2.53 2.54 2.55 2.56 2.57 2.58 2.59 2.60 2.61 2.62 2.63 2.64 2.65 2.66 2.67 2.68 2.69 2.70 2.71 2.72 2.73 2.74 2.75 2.76 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]