Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS08470 [old locus tag: SA1504 ]
- pan locus tag?: SAUPAN004299000
- symbol: SA_RS08470
- pan gene symbol?: infC
- synonym:
- product: translation initiation factor IF-3
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481GTGTCAACCATAGCAAAAGATCAAACTCAAATCAATGACAAAATTCGTGCAAAAGAATTA
CGTTTAATCGGTCAAGATGGTGAACAAATTGGTGTTAAATCAAAGCGTGAAGCTTTAGAA
ATGGCTGAACGTGTAGATTTAGACTTAGTGGTCGTTGCACCGAATGCGAAACCACCAGTT
GCAAGAATTATGGATTACGGTAAATTCAAATTCGAACAACAGAAAAAAGAAAAAGAAATG
AAAAAGAAACAAAAAATTATCAATGTTAAAGAAATTCGTTTAAGTCCAACAATTGAGGAA
CATGATTTCCAAACTAAGTTGAAAAACGGACGTAAATTCTTAACTAAAGGCGATAAATGT
AAAGTATCTATTCGTTTCAGAGGGCGTGCCATTACGCATAAGGAAATTGGTCAACGTGTG
CTAGAAAAATATGCAGATGAATGCAAAGATATAGCAACAGTTGAACAAAAACCTAAAATG
GACGGGCGTCAAATGTTTATCATGTTAGCGCCAACAGCTGAAAAATAA60
120
180
240
300
360
420
480
528
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS08470 [old locus tag: SA1504 ]
- symbol: SA_RS08470
- description: translation initiation factor IF-3
- length: 175
- theoretical pI: 10.4435
- theoretical MW: 20213.6
- GRAVY: -0.782857
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Translation factors translation initiation factor IF-3 (TIGR00168; HMM-score: 231.9)
- TheSEED: see SA1504
- PFAM: no clan defined IF3_C; Translation initiation factor IF-3, C-terminal domain (PF00707; HMM-score: 130.5)IF3_N; Translation initiation factor IF-3, N-terminal domain (PF05198; HMM-score: 106)and 1 moreNTP_transf (CL0260) NTP_transf_2; Nucleotidyltransferase domain (PF01909; HMM-score: 15.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004901
- TAT(Tat/SPI): 0.000734
- LIPO(Sec/SPII): 0.000838
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSTIAKDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPVARIMDYGKFKFEQQKKEKEMKKKQKIINVKEIRLSPTIEEHDFQTKLKNGRKFLTKGDKCKVSIRFRGRAITHKEIGQRVLEKYADECKDIATVEQKPKMDGRQMFIMLAPTAEK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SA_RS01710 5'-nucleotidase, lipoprotein e(P4) family [2] (data from MRSA252) SA_RS02015 30S ribosomal protein S6 [2] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [2] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [2] (data from MRSA252) SA_RS02920 50S ribosomal protein L7/L12 [2] (data from MRSA252) SA_RS02945 30S ribosomal protein S12 [2] (data from MRSA252) SA_RS02950 30S ribosomal protein S7 [2] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [2] (data from MRSA252) SA_RS06315 30S ribosomal protein S15 [2] (data from MRSA252) SA_RS07385 DNA-binding protein HU [2] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [2] (data from MRSA252) SA_RS08600 universal stress protein [2] (data from MRSA252) SA_RS08675 30S ribosomal protein S4 [2] (data from MRSA252) SA_RS11600 30S ribosomal protein S9 [2] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [2] (data from MRSA252) SA_RS11670 50S ribosomal protein L15 [2] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [2] (data from MRSA252) SA_RS11690 50S ribosomal protein L6 [2] (data from MRSA252) SA_RS11720 30S ribosomal protein S17 [2] (data from MRSA252) SA_RS11730 50S ribosomal protein L16 [2] (data from MRSA252) SA_RS11735 30S ribosomal protein S3 [2] (data from MRSA252) SA_RS11740 50S ribosomal protein L22 [2] (data from MRSA252) SA_RS11745 30S ribosomal protein S19 [2] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [2] (data from MRSA252) SA_RS11755 50S ribosomal protein L23 [2] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [2] (data from MRSA252) SA_RS11765 50S ribosomal protein L3 [2] (data from MRSA252) SA_RS11770 30S ribosomal protein S10 [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: L20 leader see SA1504
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)