Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1627 [new locus tag: SAUSA300_RS08875 ]
- pan locus tag?: SAUPAN004299000
- symbol: infC
- pan gene symbol?: infC
- synonym:
- product: translation initiation factor IF-3
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1627 [new locus tag: SAUSA300_RS08875 ]
- symbol: infC
- product: translation initiation factor IF-3
- replicon: chromosome
- strand: -
- coordinates: 1779878..1780405
- length: 528
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913793 NCBI
- RefSeq: YP_494322 NCBI
- BioCyc: see SAUSA300_RS08875
- MicrobesOnline: 1293142 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481GTGTCAACCATAGCAAAAGATCAAACTCAAATCAATGACAAAATTCGTGCAAAAGAATTA
CGTTTAATCGGTCAAGATGGTGAACAAATTGGTGTTAAATCAAAGCGTGAAGCTTTAGAA
ATGGCTGAACGTGTAGATTTAGACTTAGTGGTCGTTGCACCGAATGCGAAACCACCAGTT
GCAAGAATTATGGATTACGGTAAATTCAAATTCGAACAACAGAAAAAAGAAAAAGAAATG
AAAAAGAAACAAAAAATTATCAATGTTAAAGAAATTCGTTTAAGTCCAACAATTGAGGAA
CATGATTTCCAAACGAAGTTGAAAAACGGACGTAAATTCTTAACTAAAGGCGATAAATGT
AAAGTATCTATTCGTTTCAGAGGGCGTGCCATTACGCATAAGGAAATTGGTCAACGTGTG
CTAGAAAAATATGCAGATGAATGCAAAGATATAGCAACAGTTGAACAAAAACCTAAAATG
GACGGGCGTCAAATGTTTATCATGTTAGCGCCAACAGCTGAAAAATAA60
120
180
240
300
360
420
480
528
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1627 [new locus tag: SAUSA300_RS08875 ]
- symbol: InfC
- description: translation initiation factor IF-3
- length: 175
- theoretical pI: 10.4435
- theoretical MW: 20213.6
- GRAVY: -0.782857
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Translation factors translation initiation factor IF-3 (TIGR00168; HMM-score: 231.9)
- TheSEED :
- Translation initiation factor 3
Protein Metabolism Protein biosynthesis Translation initiation factors bacterial Translation initiation factor 3and 1 more - PFAM: no clan defined IF3_C; Translation initiation factor IF-3, C-terminal domain (PF00707; HMM-score: 129.3)IF3_N; Translation initiation factor IF-3, N-terminal domain (PF05198; HMM-score: 115.5)and 2 moreNTP_transf (CL0260) NTP_transf_2; Nucleotidyltransferase domain (PF01909; HMM-score: 14.7)no clan defined DUF6465; Family of unknown function (DUF6465) (PF20069; HMM-score: 13.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9961
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.0039
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004901
- TAT(Tat/SPI): 0.000734
- LIPO(Sec/SPII): 0.000838
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSTIAKDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPVARIMDYGKFKFEQQKKEKEMKKKQKIINVKEIRLSPTIEEHDFQTKLKNGRKFLTKGDKCKVSIRFRGRAITHKEIGQRVLEKYADECKDIATVEQKPKMDGRQMFIMLAPTAEK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_1362 (hup) DNA-binding protein HU [1] (data from MRSA252) SAUSA300_0523 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SAUSA300_2201 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SAUSA300_2204 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SAUSA300_2203 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SAUSA300_2189 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SAUSA300_0524 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_0525 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SAUSA300_2185 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SAUSA300_2197 (rplP) 50S ribosomal protein L16 [1] (data from MRSA252) SAUSA300_1134 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_1603 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SAUSA300_2199 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_2202 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SAUSA300_2198 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAUSA300_1666 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SAUSA300_2187 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_0366 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SAUSA300_2171 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_2205 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) SAUSA300_2179 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SAUSA300_0530 (rpsL) 30S ribosomal protein S12 [1] (data from MRSA252) SAUSA300_1166 (rpsO) 30S ribosomal protein S15 [1] (data from MRSA252) SAUSA300_2195 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SAUSA300_2200 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SAUSA300_0307 5'-nucleotidase [1] (data from MRSA252) SAUSA300_0531 30S ribosomal protein S7 [1] (data from MRSA252) SAUSA300_1652 hypothetical protein [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: rplT < rpmI < infC
⊟Regulation[edit | edit source]
- regulator: L20 leader (transcription termination) regulon
L20 leader (RNA) important in Ribosome biogenesis; regulatory site identified based on RegPrecise data for N315 RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)