From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2135 [new locus tag: NWMN_RS12340 ]
  • pan locus tag?: SAUPAN005685000
  • symbol: rpsE
  • pan gene symbol?: rpsE
  • synonym:
  • product: 30S ribosomal protein S5

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2135 [new locus tag: NWMN_RS12340 ]
  • symbol: rpsE
  • product: 30S ribosomal protein S5
  • replicon: chromosome
  • strand: -
  • coordinates: <2367334..2367822
  • length: 489
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGCTCGTAGAGAAGAAGAGACGAAAGAATTTGAAGAACGCGTTGTTACAATCAACCGT
    GTAGCAAAAGTTGTAAAAGGTGGTCGTCGTTTCCGTTTCACTGCATTAGTTGTAGTTGGA
    GACAAAAATGGTCGTGTAGGTTTCGGTACTGGTAAAGCTCAAGAGGTACCAGAAGCAATC
    AAAAAAGCTGTTGAAGCAGCTAAAAAAGATTTAGTAGTTGTTCCACGTGTTGAAGGTACA
    ACTCCACACACAATTACTGGCCGTTACGGTTCAGGAAGCGTATTTATGAAACCGGCTGCA
    CCTGGTACAGGAGTTATCGCTGGTGGTCCTGTTCGTGCCGTACTTGAATTAGCAGGTATC
    ACTGATATCTTAAGTAAATCATTAGGATCAAACACACCAATCAACATGGTTCGTGCTACA
    ATCGATGGTTTACAAAACCTTAAAAATGCTGAAGATGTTGCGAAATTACGTGGCAAAACA
    GTAGAAGAA
    60
    120
    180
    240
    300
    360
    420
    480
    489

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2135 [new locus tag: NWMN_RS12340 ]
  • symbol: RpsE
  • description: 30S ribosomal protein S5
  • length: 163
  • theoretical pI: 10.6781
  • theoretical MW: 17351.9
  • GRAVY: -0.20184

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS5 (TIGR01021; HMM-score: 233.6)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS5 (TIGR01020; HMM-score: 108.5)
  • TheSEED:  
    Protein Metabolism Protein biosynthesis Ribosome SSU bacterial  SSU ribosomal protein S5p (S2e)
    and 2 more
    Single-copy ribosomal proteins  SSU ribosomal protein S5p (S2e)
    Protein processing and modification Ribosomal protein S5p acylation  SSU ribosomal protein S5p (S2e)
  • PFAM:
    S5 (CL0329) Ribosomal_S5_C; Ribosomal protein S5, C-terminal domain (PF03719; HMM-score: 112.1)
    DSRM (CL0196) Ribosomal_S5; Ribosomal protein S5, N-terminal domain (PF00333; HMM-score: 103.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010797
    • TAT(Tat/SPI): 0.009728
    • LIPO(Sec/SPII): 0.00158
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEE

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]