From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001799
  • pan locus tag?: SAUPAN004547000
  • symbol: JSNZ_001799
  • pan gene symbol?: —
  • synonym:
  • product: WXG100 family type VII secretion target

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001799
  • symbol: JSNZ_001799
  • product: WXG100 family type VII secretion target
  • replicon: chromosome
  • strand: +
  • coordinates: 1845953..1846252
  • length: 300
  • essential: unknown

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGCTCAAAAGATGCAAAGAAAAGTCAAGAAGAAGCTAGATTACAACAATTAAAGCAA
    GAAATGCGTAATAGTACTGATAATATGGTTAGCAACGCTAAAAATAATGTAGCATTAAAA
    TCTCAAACATTGAATGAAATCATTGAAACAATTAATAATTCTTCGCAAAATTTAGAAGGT
    ACATTTGAAGGAAAAGCAAGCGAAGCGGCCCAACAAAGTATAAATAAACTCAAAAGCAAT
    AATGAAAATCTTAAACAAAAATTTGAGACCCTATTAAATACAATGAAGATAAATGGATAA
    60
    120
    180
    240
    300

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_001799
  • symbol: JSNZ_001799
  • description: WXG100 family type VII secretion target
  • length: 99
  • theoretical pI: 9.78511
  • theoretical MW: 11089.3
  • GRAVY: -1.06162

⊟Function[edit | edit source]

  • TIGRFAM:
    WXG100 family type VII secretion target (TIGR03930; HMM-score: 29.2)
    and 9 more
    Cellular processes Cellular processes Pathogenesis virulence factor Mce family protein (TIGR00996; HMM-score: 13.4)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AB (TIGR02833; HMM-score: 13)
    Genetic information processing Protein fate Protein folding and stabilization chaperone protein DnaK (TIGR02350; HMM-score: 9.9)
    phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 9.5)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair double-strand break repair protein AddB (TIGR02786; HMM-score: 9.2)
    Genetic information processing DNA metabolism Degradation of DNA exodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 8.4)
    alternate F1F0 ATPase, F0 subunit B (TIGR03321; EC 3.6.3.-; HMM-score: 7.9)
    SH3 domain protein (TIGR04211; HMM-score: 6.5)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 3.3)
  • TheSEED:
  • PFAM:
    EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 30.5)
    and 32 more
    POZ (CL0033) Skp1_POZ; Skp1 family, tetramerisation domain (PF03931; HMM-score: 16.8)
    no clan defined DUF2884; Protein of unknown function (DUF2884) (PF11101; HMM-score: 16.3)
    PI3K_P85_iSH2; Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain (PF16454; HMM-score: 14.4)
    DUF2533; Protein of unknown function (DUF2533) (PF10752; HMM-score: 12.9)
    P-loop_NTPase (CL0023) MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 12.1)
    no clan defined HSCB_C; HSCB C-terminal oligomerisation domain (PF07743; HMM-score: 12.1)
    Actin_ATPase (CL0108) HSP70; Hsp70 protein (PF00012; HMM-score: 11.7)
    no clan defined Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 11.5)
    BECR (CL0688) PBECR5; phage-Barnase-EndoU-ColicinE5/D-RelE like nuclease5 (PF18814; HMM-score: 11.4)
    no clan defined DUF4837; Domain of unknown function (DUF4837) (PF16125; HMM-score: 11.3)
    TPR (CL0020) RPN1_RPN2_N; RPN1 N-terminal domain (PF17781; HMM-score: 11.1)
    no clan defined DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 10.9)
    TACC (CL0679) TACC_C; Transforming acidic coiled-coil-containing protein (TACC), C-terminal (PF05010; HMM-score: 10.8)
    no clan defined Muted; Organelle biogenesis, Muted-like protein (PF14942; HMM-score: 10.8)
    DUF7609; Domain of unknown function (DUF7609) (PF24582; HMM-score: 10.7)
    DUF641; Plant protein of unknown function (DUF641) (PF04859; HMM-score: 9.8)
    Nbl1_Borealin_N; Nbl1 / Borealin N terminal (PF10444; HMM-score: 9.8)
    Allexi_40kDa; Allexivirus 40kDa protein (PF05549; HMM-score: 9.6)
    VPS11_C; Vacuolar protein sorting protein 11 C terminal (PF12451; HMM-score: 9.1)
    DUF724; Protein of unknown function (DUF724) (PF05266; HMM-score: 8.8)
    AllH; Oxamate carbamoyltransferase subunit AllH (PF11392; HMM-score: 8.8)
    ZYG-11_interact; Interactor of ZYG-11 (PF05884; HMM-score: 8.4)
    ApoO; Apolipoprotein O (PF09769; HMM-score: 8.3)
    VBS-like (CL0705) VBS_C3G9; C3G9 VBS-like domain (PF23742; HMM-score: 8.3)
    PIN (CL0280) PIN_8; PIN like domain (PF18476; HMM-score: 8.1)
    no clan defined Prominin; Prominin (PF05478; HMM-score: 8)
    DUF6779; Domain of unknown function (DUF6779) (PF20570; HMM-score: 7.8)
    CCDC90-like; Coiled-coil domain-containing protein 90-like (PF07798; HMM-score: 7.7)
    YtxH; YtxH-like protein (PF12732; HMM-score: 7.2)
    E2F_CC-MB; E2F transcription factor CC-MB domain (PF16421; HMM-score: 7)
    Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 6.9)
    DUF4175; Domain of unknown function (DUF4175) (PF13779; HMM-score: 6.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.1263
    • Cytoplasmic Membrane Score: 0.0016
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.8716
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013545
    • TAT(Tat/SPI): 0.003589
    • LIPO(Sec/SPII): 0.001176
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MSSKDAKKSQEEARLQQLKQEMRNSTDNMVSNAKNNVALKSQTLNEIIETINNSSQNLEGTFEGKASEAAQQSINKLKSNNENLKQKFETLLNTMKING

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=JSNZ_001799&oldid=107440"