(Redirected from JSNZ 002198)
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002198 [new locus tag: EGJ38_RS10970 ]
- pan locus tag?: SAUPAN005686000
- symbol: rplR
- pan gene symbol?: rplR
- synonym:
- alternate name: JSNZ_002198
- product: 50S ribosomal protein L18
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002198 [new locus tag: EGJ38_RS10970 ]
- symbol: rplR
- product: 50S ribosomal protein L18
- replicon: chromosome
- strand: -
- coordinates: 2208037..2208396
- length: 360
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424087 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATCAGTAAAATTGATAAAAATAAAGTGCGTTTAAAAAGACATGCTCGTGTTCGTACT
AACTTATCAGGTACAGCTGAAAAGCCACGTTTAAACGTATATCGTTCAAACAAGCATATC
TACGCTCAAATTATTGATGATAATAAAGGCGTAACATTAGCTCAAGCTTCTTCAAAAGAC
AGCGACATTGCTACTAAAGCAACTAAAGTTGAATTAGCAACTAAAGTCGGTGAAGCAATT
GCTAAAAAAGCTGCTGACAAAGGCATTAAAGAAATCGTATTTGACCGTGGAGGATATTTA
TATCACGGACGTGTTAAAGCATTAGCTGAAGCAGCAAGAGAAAGCGGATTAGAATTTTAA60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002198 [new locus tag: EGJ38_RS10970 ]
- symbol: RplR
- description: 50S ribosomal protein L18
- length: 119
- theoretical pI: 10.6621
- theoretical MW: 13124
- GRAVY: -0.546219
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL18 (TIGR00060; HMM-score: 142.9)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: S11_L18p (CL0267) Ribosomal_L18p; Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast (PF00861; HMM-score: 159.1)and 1 moreno clan defined DICT; Sensory domain in DIguanylate Cyclases and Two-component system (PF10069; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.3045
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.6955
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011808
- TAT(Tat/SPI): 0.001341
- LIPO(Sec/SPII): 0.002829
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424087 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATKATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAEAARESGLEF
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)