(Redirected from JSNZ 002201)
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002201 [new locus tag: EGJ38_RS10985 ]
- pan locus tag?: SAUPAN005689000
- symbol: rpsN
- pan gene symbol?: rpsN
- synonym:
- alternate name: JSNZ_002201
- product: type Z 30S ribosomal protein S14
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002201 [new locus tag: EGJ38_RS10985 ]
- symbol: rpsN
- product: type Z 30S ribosomal protein S14
- replicon: chromosome
- strand: -
- coordinates: 2209418..2209603
- length: 186
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2424090 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGGCTAAAACTTCAATGGTTGCTAAGCAACAAAAAAAACAAAAATATGCAGTTCGTGAA
TACACTCGTTGTGAACGTTGTGGCCGTCCACATTCTGTATATCGTAAATTTAAATTATGC
CGTATTTGTTTCCGTGAATTAGCTTACAAAGGCCAAATCCCTGGCGTTCGTAAAGCTAGC
TGGTAA60
120
180
186
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002201 [new locus tag: EGJ38_RS10985 ]
- symbol: RpsN
- description: type Z 30S ribosomal protein S14
- length: 61
- theoretical pI: 10.9538
- theoretical MW: 7299.67
- GRAVY: -0.840984
⊟Function[edit | edit source]
- TIGRFAM: Hypothetical proteins Conserved TIGR00269 family protein (TIGR00269; HMM-score: 14.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Tbcl_zf (CL0839) Ribosomal_S14; Ribosomal protein S14p/S29e (PF00253; HMM-score: 88.4)and 3 moreZn_Beta_Ribbon (CL0167) DZR_2; Double zinc ribbon domain (PF18912; HMM-score: 15.8)no clan defined DUF6011; Family of unknown function (DUF6011) (PF19474; HMM-score: 13.6)C2H2-zf (CL0361) zf_C2H2_13; Zinc Finger domain (PF18508; HMM-score: 7.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4801
- Cytoplasmic Membrane Score: 0.0015
- Cell wall & surface Score: 0
- Extracellular Score: 0.5184
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.065025
- TAT(Tat/SPI): 0.015035
- LIPO(Sec/SPII): 0.00934
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2424090 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)