Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_002538
- pan locus tag?: SAUPAN006222000
- symbol: copZ
- pan gene symbol?: copZ
- synonym:
- product: copper chaperone CopZ
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_002538
- symbol: copZ
- product: copper chaperone CopZ
- replicon: chromosome
- strand: +
- coordinates: 2547038..2547244
- length: 207
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTCACAAGAAATTTTAAATGTTGAAGGTATGAGCTGTGGTCACTGCAAAAGTGCTGTT
GAATCTGCATTAAATAATATTGACGGTGTCACTTCAGCTGACGTTAACCTTGAAAATGGT
CAAGTAAGTGTTCAATATGATGACAGTAAAGTTGCTGTATCTCAAATGAAAGACGCAATT
GAAGATCAAGGTTACGATGTCGTTTAA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_002538
- symbol: CopZ
- description: copper chaperone CopZ
- length: 68
- theoretical pI: 3.74526
- theoretical MW: 7236.9
- GRAVY: -0.25
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds copper ion binding protein (TIGR00003; HMM-score: 72.3)and 1 moreCellular processes Detoxification mercuric transport protein periplasmic component (TIGR02052; HMM-score: 54)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HMA (CL0704) HMA; Heavy-metal-associated domain (PF00403; HMM-score: 68.2)and 5 moreno clan defined DUF6286; Family of unknown function (DUF6286) (PF19803; HMM-score: 20.2)HMA (CL0704) HMA_2; Heavy metal associated domain 2 (PF19991; HMM-score: 17.5)no clan defined Vta1_C; Vta1 C-terminal domain (PF18097; HMM-score: 13.9)Zn_Beta_Ribbon (CL0167) DUF7479; Domain of unknown function (DUF7479) (PF24292; HMM-score: 12.7)Zn_ribbon_DUF2089; DUF2089 zinc ribbon (PF22747; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9785
- Cytoplasmic Membrane Score: 0.0028
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0186
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.016738
- TAT(Tat/SPI): 0.001113
- LIPO(Sec/SPII): 0.004887
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MSQEILNVEGMSCGHCKSAVESALNNIDGVTSADVNLENGQVSVQYDDSKVAVSQMKDAIEDQGYDVV
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : JSNZ_002537 > copZ
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)