From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0051 [new locus tag: NWMN_RS00295 ]
  • pan locus tag?: SAUPAN000903000
  • symbol: NWMN_0051
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0051 [new locus tag: NWMN_RS00295 ]
  • symbol: NWMN_0051
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 68200..69072
  • length: 873
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAATAAACTTCGAGACACTACTTTTCTATCATATTTATTTACTATCATATTGTGGGGA
    TCTGCATTTCCAATGATAAAGATTGCGTTAAATGATTTTAGTGCAGAATCATTGTCGGCA
    TTTCGTTTAATTTTAGCAACAATAATTCTCTTGCCGTTCGTAATTATAAAGAAATTGCCT
    ACCCCTGAACTAAGAGATATCCCTGTTATTTTTATTTTAGGATTTTGTGGATTTGTGATA
    TATCACACAGCTTTAAATTTTGGTGAAACTTTGATTAGTGCAGGTATATCTGGAATTCTA
    GTCTCTACAACGCCTATTTTTTCTAGTGCTTTAGCTTATATATTTTTAAAAGAGCATTTT
    TCAAAATGGAATTGGTTAAGTTCACTCGTCGCATTTATAGGAATATCCATTATTTCAATA
    AGTAAAGATGATTACACAACTATTAATGTATTAGGTGTTTTTATTATTTTACTTGCATCT
    TTTAGTGAAAGTTTGTATTTTACTTTCCAGAAAAAATACATAGAAAAATACGGCTTCATC
    GCTTTCACACTATATACAATAATGGCAAGCTCACCATTTATGCTTATTTTTATTCCTGAA
    ATCATCAACGATATACACGGCGCCACTTTTACATCAATAGTATCGGTACTTTATTTAGCT
    ATATTCCCTACTATAATTCCATACGTTTTGCTTGCTTATATTGTGAAGTCAGTTGGTGTC
    TCTGATGCAACAATGTCTCTTTATTTAACACCTATCGTTTCTTTATTATTATCTTATCTG
    TTATTAGACGAGCTACCAACAACCCTTGCTATTATAGGCGGAATTATCACTCTACTAGGC
    GTTAGTTTAAGTAACTTCTTTCAAAATACATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    873

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0051 [new locus tag: NWMN_RS00295 ]
  • symbol: NWMN_0051
  • description: hypothetical protein
  • length: 290
  • theoretical pI: 6.2511
  • theoretical MW: 32209.2
  • GRAVY: 1.03483

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Amino acids, peptides and amines carboxylate/amino acid/amine transporter (TIGR00950; HMM-score: 110.3)
    and 2 more
    Hypothetical proteins Conserved Tpt phosphate/phosphoenolpyruvate translocator (TIGR00817; HMM-score: 17.9)
    Metabolism Transport and binding proteins Unknown substrate protein RarD (TIGR00688; HMM-score: 15.8)
  • TheSEED:  
    RNA Metabolism RNA processing and modification Queuosine-Archaeosine Biosynthesis  Permease of the drug/metabolite transporter (DMT) superfamily
    and 3 more
    Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Cobalt-zinc-cadmium resistance  Permease of the drug/metabolite transporter (DMT) superfamily
    Queuosine exploration RZ  Permease of the drug/metabolite transporter (DMT) superfamily
    Test Q  Permease of the drug/metabolite transporter (DMT) superfamily
  • PFAM:
    DMT (CL0184) EamA; EamA-like transporter family (PF00892; HMM-score: 154.7)
    and 2 more
    TPT; Triose-phosphate Transporter family (PF03151; HMM-score: 24.4)
    EmrE; Putative multidrug resistance efflux transporter (PF13536; HMM-score: 20.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 10
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.057613
    • TAT(Tat/SPI): 0.009079
    • LIPO(Sec/SPII): 0.018061
  • predicted transmembrane helices (TMHMM): 10

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNKLRDTTFLSYLFTIILWGSAFPMIKIALNDFSAESLSAFRLILATIILLPFVIIKKLPTPELRDIPVIFILGFCGFVIYHTALNFGETLISAGISGILVSTTPIFSSALAYIFLKEHFSKWNWLSSLVAFIGISIISISKDDYTTINVLGVFIILLASFSESLYFTFQKKYIEKYGFIAFTLYTIMASSPFMLIFIPEIINDIHGATFTSIVSVLYLAIFPTIIPYVLLAYIVKSVGVSDATMSLYLTPIVSLLLSYLLLDELPTTLAIIGGIITLLGVSLSNFFQNT

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • NWMN_0051 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]