From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0246 [new locus tag: NWMN_RS01360 ]
  • pan locus tag?: SAUPAN001222000
  • symbol: NWMN_0246
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0246 [new locus tag: NWMN_RS01360 ]
  • symbol: NWMN_0246
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 300231..300629
  • length: 399
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGAAAAATCGATCAAAATAATGACAATAATAGGAATTGTTGTTCAGGGTTTAGCAACG
    GTATTTAGTTTACTATTGATGGTTTTAGCAGCATCAGGTGTAATGACTACAGATGTGTCA
    ACAACAGTTAATGGTGAGGTTGACCCAGTTGATGCAGAAACAGCAGCAGCAATTTTCACT
    GTATTATTCTTATCCCTATTCATATTTGGAATCATTTCAATTATTTTAGGTGCAATCGGT
    ATGTTTAAAGCATCTAAAAACAAAAAAATGAGTGGTATATTGTTGATTATTGGAGCTGTA
    ATAAGTGGTAACATAATTACATTTGCTTTATGGTTAATCAGTGGTATTAAACTACTTACT
    AATAACAAGCCTAAAGATGAAATAAGCGACTTATCATAA
    60
    120
    180
    240
    300
    360
    399


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0246 [new locus tag: NWMN_RS01360 ]
  • symbol: NWMN_0246
  • description: hypothetical protein
  • length: 132
  • theoretical pI: 6.77736
  • theoretical MW: 13902.7
  • GRAVY: 1.05758

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • hypothetical protein
  • PFAM:
    TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 73)
    and 9 more
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 19.8)
    Gx_transp (CL0315) ECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 13.2)
    no clan defined DUF2545; Protein of unknown function (DUF2545) (PF10810; HMM-score: 12.5)
    TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 10.9)
    no clan defined Myelin_PLP; Myelin proteolipid protein (PLP or lipophilin) (PF01275; HMM-score: 8.9)
    DUF6057; Family of unknown function (DUF6057) (PF19529; HMM-score: 8.8)
    Holin-V (CL0562) Phage_holin_5_2; Phage holin family Hol44, in holin superfamily V (PF16079; HMM-score: 8.5)
    no clan defined DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 7.5)
    DUF2976; Protein of unknown function (DUF2976) (PF11190; HMM-score: 7.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.6783
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.3214
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.136735
    • TAT(Tat/SPI): 0.011761
    • LIPO(Sec/SPII): 0.127787
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MEKSIKIMTIIGIVVQGLATVFSLLLMVLAASGVMTTDVSTTVNGEVDPVDAETAAAIFTVLFLSLFIFGIISIILGAIGMFKASKNKKMSGILLIIGAVISGNIITFALWLISGIKLLTNNKPKDEISDLS

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]