Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0300 [new locus tag: SACOL_RS01515 ]
- pan locus tag?: SAUPAN001222000
- symbol: SACOL0300
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0300 [new locus tag: SACOL_RS01515 ]
- symbol: SACOL0300
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 334167..334565
- length: 399
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236787 NCBI
- RefSeq: YP_185193 NCBI
- BioCyc: see SACOL_RS01515
- MicrobesOnline: 911772 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGAAAAATCGATCAAAATAATGACAATAATAGGAATTGTTGTTCAGGGTTTAGCAACG
GTATTTAGTTTACTATTGATGGTTTTAGCAGCATCAGGTGTAATGACTACAGATGTGTCA
ACAACAGTTAATGGTGAGGTTGACCCAGTTGATGCAGAAACAGCAGCAGCAATTTTCACT
GTATTATTCTTATCCCTATTCATATTTGGAATCATTTCAATTATTTTAGGTGCAATCGGT
ATGTTTAAAGCATCTAAAAACAAAAAAATGAGTGGTATATTGTTGATTATTGGAGCTGTA
ATAAGTGGTAACATAATTACATTTGCTTTATGGTTAATCAGTGGTATTAAACTACTTACT
AATAACAAGCCTAAAGATGAAATAAGCGACTTATCATAA60
120
180
240
300
360
399
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0300 [new locus tag: SACOL_RS01515 ]
- symbol: SACOL0300
- description: hypothetical protein
- length: 132
- theoretical pI: 6.77736
- theoretical MW: 13902.7
- GRAVY: 1.05758
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- hypothetical protein
- PFAM: TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 73)and 9 moreYip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 19.8)Gx_transp (CL0315) ECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 13.2)no clan defined DUF2545; Protein of unknown function (DUF2545) (PF10810; HMM-score: 12.5)TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 10.9)no clan defined Myelin_PLP; Myelin proteolipid protein (PLP or lipophilin) (PF01275; HMM-score: 8.9)DUF6057; Family of unknown function (DUF6057) (PF19529; HMM-score: 8.8)Holin-V (CL0562) Phage_holin_5_2; Phage holin family Hol44, in holin superfamily V (PF16079; HMM-score: 8.5)no clan defined DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 7.5)DUF2976; Protein of unknown function (DUF2976) (PF11190; HMM-score: 7.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.6783
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.3214
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.136735
- TAT(Tat/SPI): 0.011761
- LIPO(Sec/SPII): 0.127787
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEKSIKIMTIIGIVVQGLATVFSLLLMVLAASGVMTTDVSTTVNGEVDPVDAETAAAIFTVLFLSLFIFGIISIILGAIGMFKASKNKKMSGILLIIGAVISGNIITFALWLISGIKLLTNNKPKDEISDLS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: Integral membrane [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)