Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0402 [new locus tag: NWMN_RS02275 ]
- pan locus tag?: SAUPAN002132000
- symbol: NWMN_0402
- pan gene symbol?: —
- synonym: spn
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0402 [new locus tag: NWMN_RS02275 ]
- symbol: NWMN_0402
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 452545..452862
- length: 318
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330217 NCBI
- RefSeq: YP_001331436 NCBI
- BioCyc:
- MicrobesOnline: 3705933 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301GTGATAGATATGAAATTTAAAAAGGTTTTAGTAGCTACGGCAATGGTAGGTGTTTTAGCA
ACTGGCGTTGTTGGATATGGTAATCAAGCAGATGCGAAAGTTTATTCTCAAAATGGACTC
GTACTACATGATGATGCAAACTTCTTAGAACATGAATTAAGTTATATTGATGTGTTATTA
GATAAGAATGCTGACCAAGCTACAAAAGACAACTTAAGATCATACTTCGCCGATAAAGGA
CTACATTCAATCAAAGACATTATCAACAAAGCTAAACAAGACGGCTTTGATGTTTCAAAA
TATGAACACGTAAAATAA60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0402 [new locus tag: NWMN_RS02275 ]
- symbol: NWMN_0402
- description: hypothetical protein
- length: 105
- theoretical pI: 6.51378
- theoretical MW: 11661.2
- GRAVY: -0.241905
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108371: hypothetical protein
- PFAM: O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.0011
- Cell wall & surface Score: 0.0705
- Extracellular Score: 0.9283
- LocateP: N-terminally anchored (with CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: GNQADAKV
- SignalP: Signal peptide SP(Sec/SPI) length 32 aa
- SP(Sec/SPI): 0.934173
- TAT(Tat/SPI): 0.004223
- LIPO(Sec/SPII): 0.030337
- Cleavage Site: CS pos: 32-33. ADA-KV. Pr: 0.7279
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIDMKFKKVLVATAMVGVLATGVVGYGNQADAKVYSQNGLVLHDDANFLEHELSYIDVLLDKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]