Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0395 [new locus tag: SA_RS02265 ]
- pan locus tag?: SAUPAN002132000
- symbol: SA0395
- pan gene symbol?: —
- synonym: spn
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0395 [new locus tag: SA_RS02265 ]
- symbol: SA0395
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 456444..456752
- length: 309
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123179 NCBI
- RefSeq: NP_373646 NCBI
- BioCyc: see SA_RS02265
- MicrobesOnline: 102672 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAATTTAAAAAGGTTTTAGTAGCTACGGCAATGGTAGGTGTATTAGCAACTGGCGTT
GTTGGATATGGTAATCAAGCAGATGCGAAAGTTTATTCTCAAAATGGACTCGTACTACAT
GATGACGCAAACTTCTTAGAACATGAATTAAGCTATATCGATGTGTTATTAGATAAGAAT
GCTGACCAAGCTACAAAAGACAACTTAAGATCATACTTCGCCGATAAAGGACTACATTCA
ATCAAAGACATTATCAACAAAGCTAAGCAAGACGGCTTTGATGTTTCAAAATATGAACAC
GTAAAATAA60
120
180
240
300
309
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0395 [new locus tag: SA_RS02265 ]
- symbol: SA0395
- description: hypothetical protein
- length: 102
- theoretical pI: 6.96878
- theoretical MW: 11301.8
- GRAVY: -0.277451
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.0007
- Cell wall & surface Score: 0.1069
- Extracellular Score: 0.8923
- LocateP: N-terminally anchored (with CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: GNQADAKV
- SignalP: Signal peptide SP(Sec/SPI) length 29 aa
- SP(Sec/SPI): 0.963769
- TAT(Tat/SPI): 0.000991
- LIPO(Sec/SPII): 0.026884
- Cleavage Site: CS pos: 29-30. ADA-KV. Pr: 0.7568
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFKKVLVATAMVGVLATGVVGYGNQADAKVYSQNGLVLHDDANFLEHELSYIDVLLDKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]