Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000370 [new locus tag: EGJ38_RS01850 ]
- pan locus tag?: SAUPAN002132000
- symbol: spn
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000370
- product: myeloperoxidase inhibitor SPIN
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000370 [new locus tag: EGJ38_RS01850 ]
- symbol: spn
- product: myeloperoxidase inhibitor SPIN
- replicon: chromosome
- strand: -
- coordinates: 403933..404241
- length: 309
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422371 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAATTTAAAAAGGTTTTAGTAGCTACGGCAATGGTAGGTGTTTTAGCAACTGGCGTT
GTTGGATATGGTAATCAAGCAGATGCGAAAGTGTATTCTCAAAATGGACTCGTACTACAT
GATGACGCAAACTTCTTAGAACACGAGTTAAGTTATATCGATGTGTTATTAGATAAGAAT
GCTGACCAAGCTACAAAAGACAACTTAAGATCATACTTCGCCGATAAAGGACTACATTCA
ATCAAAGACATTATCAACAAAGCTAAGCAAGACGGCTTTGATGTTTCAAAATATGAACAC
GTAAAATAA60
120
180
240
300
309
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000370 [new locus tag: EGJ38_RS01850 ]
- symbol: Spn
- description: myeloperoxidase inhibitor SPIN
- length: 102
- theoretical pI: 6.96878
- theoretical MW: 11301.8
- GRAVY: -0.277451
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.0007
- Cell wall & surface Score: 0.1069
- Extracellular Score: 0.8923
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 29 aa
- SP(Sec/SPI): 0.963769
- TAT(Tat/SPI): 0.000991
- LIPO(Sec/SPII): 0.026884
- Cleavage Site: CS pos: 29-30. ADA-KV. Pr: 0.7568
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422371 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFKKVLVATAMVGVLATGVVGYGNQADAKVYSQNGLVLHDDANFLEHELSYIDVLLDKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]