From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0552 [new locus tag: NWMN_RS03165 ]
  • pan locus tag?: SAUPAN002369000
  • symbol: NWMN_0552
  • pan gene symbol?: lipL
  • synonym:
  • product: lipoate-protein ligase A protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0552 [new locus tag: NWMN_RS03165 ]
  • symbol: NWMN_0552
  • product: lipoate-protein ligase A protein
  • replicon: chromosome
  • strand: +
  • coordinates: 635627..636463
  • length: 837
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGGATTTAGCGAGTAAATATTTTAATGGCGTCAACTGGCGATATATCGATCATTCTTCT
    GGATTAGAACCTATGCAATCTTTCGCATTCGATGATACATTTTGCGAAAGTGTGGGCAAA
    GATATATCAGATAATGTTGTGCGTACTTGGATTCATCAACATACTGTTATTCTTGGTATT
    CATGATTCAAGATTGCCGTTTTTAAAAGATGGCATTGATTATTTAACGAATGAGATTGGT
    TATAATGCCATTGTTAGAAATTCTGGTGGCTTAGGTGTCGTTCTAGATCAAGGTGTATTA
    AATATATCGCTGATGTTCAAAGGACAAACAGAAACAACGATTGATGAAGCGTTTACTGTG
    ATGTACCTCTTAATTAGCAAAATGTTCGAAAATGAGAATGTTGATATTGATACGATGGAA
    ATTGAACATTCTTATTGCCCAGGAAAATTTGACTTAAGTATCGATGGTAAGAAATTTGCA
    GGCATATCGCAACGAAGAGTTAGAGGCGGTATTGCTGTACAAATTTATCTTTGTGTTGAA
    GGCTCTGGTTCAGAACGTGCATTGATGATGCAAACATTTTATGAACATGCTTTAAAAGGT
    GAAGTGACTAAATTTAAATATCCTGAAATTGAACCATCTTGTATGGCCTCATTAGAGACA
    TTGCTTAACAAAACGATTACTGTTCAAGATGTAATGTTTTTACTATTATATGCAATCAAA
    GATCTTGGCGGTGTATTAAATATGACGCCAATTACTCAAGAAGAATGGCAAAGATACGAT
    ACGTATTTTGATAAAATGATTGAAAGAAACAAGAAAATGATAGATCAAATGCAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    837

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0552 [new locus tag: NWMN_RS03165 ]
  • symbol: NWMN_0552
  • description: lipoate-protein ligase A protein
  • length: 278
  • theoretical pI: 4.66423
  • theoretical MW: 31735.2
  • GRAVY: -0.161151

Function[edit | edit source]

  • reaction:
    EC 2.3.1.204?  ExPASy
    Octanoyl-[GcvH]:protein N-octanoyltransferase [Glycine cleavage system H]-N6-octanoyl-L-lysine + a [lipoyl-carrier protein] = glycine cleavage system H + a [lipoyl-carrier protein]-N6-octanoyl-L-lysine
  • TIGRFAM:
    Genetic information processing Protein fate Protein modification and repair lipoyltransferase and lipoate-protein ligase (TIGR00545; HMM-score: 18.3)
  • TheSEED:  
    Carbohydrates Central carbohydrate metabolism Dehydrogenase complexes  Lipoate-protein ligase A
    and 2 more
    Cofactors, Vitamins, Prosthetic Groups, Pigments Lipoic acid Lipoic acid metabolism  Lipoate-protein ligase A
    Lipoate transport  Lipoate-protein ligase A
  • PFAM:
    tRNA_synt_II (CL0040) BPL_LplA_LipB; Biotin/lipoate A/B protein ligase family (PF03099; HMM-score: 45)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003675
    • TAT(Tat/SPI): 0.000136
    • LIPO(Sec/SPII): 0.000416
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MDLASKYFNGVNWRYIDHSSGLEPMQSFAFDDTFCESVGKDISDNVVRTWIHQHTVILGIHDSRLPFLKDGIDYLTNEIGYNAIVRNSGGLGVVLDQGVLNISLMFKGQTETTIDEAFTVMYLLISKMFENENVDIDTMEIEHSYCPGKFDLSIDGKKFAGISQRRVRGGIAVQIYLCVEGSGSERALMMQTFYEHALKGEVTKFKYPEIEPSCMASLETLLNKTITVQDVMFLLLYAIKDLGGVLNMTPITQEEWQRYDTYFDKMIERNKKMIDQMQ

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]