Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0588 [new locus tag: NWMN_RS03360 ]
- pan locus tag?: SAUPAN002485000
- symbol: sarA
- pan gene symbol?: sarA
- synonym:
- product: accessory regulator A
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0588 [new locus tag: NWMN_RS03360 ]
- symbol: sarA
- product: accessory regulator A
- replicon: chromosome
- strand: -
- coordinates: 668866..669240
- length: 375
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330326 NCBI
- RefSeq: YP_001331622 NCBI
- BioCyc:
- MicrobesOnline: 3706135 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGCAATTACAAAAATCAATGATTGCTTTGAGTTGTTATCAATGGTCACTTATGCTGAC
AAATTAAAAAGTTTAATTAAAAAGGAATTTTCAATTAGCTTTGAAGAATTCGCTGTATTG
ACATACATCAGCGAAAACAAAGAGAAAGAATACTATCTTAAAGATATTATTAATCATTTA
AACTACAAACAACCACAAGTTGTTAAAGCAGTTAAAATTTTATCTCAAGAAGATTACTTC
GATAAAAAACGTAATGAGCATGATGAAAGAACTGTATTAATTCTTGTTAATGCACAACAA
CGTAAAAAAATCGAATCATTATTGAGTCGAGTAAATAAACGAATCACTGAAGCAAACAAC
GAAATTGAACTATAA60
120
180
240
300
360
375
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0588 [new locus tag: NWMN_RS03360 ]
- symbol: SarA
- description: accessory regulator A
- length: 124
- theoretical pI: 8.4094
- theoretical MW: 14717.9
- GRAVY: -0.495968
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 118)and 6 moreCell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)Central intermediary metabolism Amino sugars UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 13)undecaprenyl-phosphate glucose phosphotransferase (TIGR03023; EC 2.7.8.-; HMM-score: 12.2)Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 11.3)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 20)MarR; MarR family (PF01047; HMM-score: 19.7)and 3 moreMarR_2; MarR family (PF12802; HMM-score: 14.5)PCI; PCI domain (PF01399; HMM-score: 14.4)P-loop_NTPase (CL0023) AAA_23; AAA domain (PF13476; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004617
- TAT(Tat/SPI): 0.000227
- LIPO(Sec/SPII): 0.000605
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)