From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00620
  • pan locus tag?: SAUPAN002485000
  • symbol: SAOUHSC_00620
  • pan gene symbol?: sarA
  • synonym:
  • product: accessory regulator A

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00620
  • symbol: SAOUHSC_00620
  • product: accessory regulator A
  • replicon: chromosome
  • strand: -
  • coordinates: 611301..611675
  • length: 375
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGCAATTACAAAAATCAATGATTGCTTTGAGTTGTTATCAATGGTCACTTATGCTGAC
    AAATTAAAAAGTTTAATTAAAAAGGAATTTTCAATTAGCTTTGAAGAATTCGCTGTATTG
    ACATACATCAGCGAAAACAAAGAGAAAGAATACTATCTTAAAGATATTATTAATCATTTA
    AACTACAAACAACCACAAGTTGTTAAAGCAGTTAAAATTTTATCTCAAGAAGATTACTTC
    GATAAAAAACGTAATGAGCATGATGAAAGAACTGTATTAATTCTTGTTAATGCACAACAA
    CGTAAAAAAATCGAATCATTATTGAGTCGAGTAAATAAACGAATCACTGAAGCAAACAAC
    GAAATTGAACTATAA
    60
    120
    180
    240
    300
    360
    375

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00620
  • symbol: SAOUHSC_00620
  • description: accessory regulator A
  • length: 124
  • theoretical pI: 8.4094
  • theoretical MW: 14717.9
  • GRAVY: -0.495968

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 118)
    and 6 more
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)
    Metabolism Central intermediary metabolism Amino sugars UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 13.3)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 13)
    undecaprenyl-phosphate glucose phosphotransferase (TIGR03023; EC 2.7.8.-; HMM-score: 12.2)
    Genetic information processing Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 11.3)
  • TheSEED  :
    • Staphylococcal accessory regulator A (SarA)
    Regulation and Cell signaling Quorum sensing and biofilm formation Biofilm formation in Staphylococcus  Staphylococcal accessory regulator A (SarA)
  • PFAM:
    HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 20)
    MarR; MarR family (PF01047; HMM-score: 19.7)
    and 3 more
    MarR_2; MarR family (PF12802; HMM-score: 14.5)
    PCI; PCI domain (PF01399; HMM-score: 14.4)
    P-loop_NTPase (CL0023) AAA_23; AAA domain (PF13476; HMM-score: 13.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004617
    • TAT(Tat/SPI): 0.000227
    • LIPO(Sec/SPII): 0.000605
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [5] [4]   other strains

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. ↑ 4.0 4.1 4.2 4.3 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)
  5. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]

J S Blevins, A F Gillaspy, T M Rechtin, B K Hurlburt, M S Smeltzer
The Staphylococcal accessory regulator (sar) represses transcription of the Staphylococcus aureus collagen adhesin gene (cna) in an agr-independent manner.
Mol Microbiol: 1999, 33(2);317-26
[PubMed:10411748] [WorldCat.org] [DOI] (P p)A Manna, A L Cheung
Characterization of sarR, a modulator of sar expression in Staphylococcus aureus.
Infect Immun: 2001, 69(2);885-96
[PubMed:11159982] [WorldCat.org] [DOI] (P p)B Fournier, A Klier, G Rapoport
The two-component system ArlS-ArlR is a regulator of virulence gene expression in Staphylococcus aureus.
Mol Microbiol: 2001, 41(1);247-61
[PubMed:11454217] [WorldCat.org] [DOI] (P p)M Bischoff, J M Entenza, P Giachino
Influence of a functional sigB operon on the global regulators sar and agr in Staphylococcus aureus.
J Bacteriol: 2001, 183(17);5171-9
[PubMed:11489871] [WorldCat.org] [DOI] (P p)P M Dunman, E Murphy, S Haney, D Palacios, G Tucker-Kellogg, S Wu, E L Brown, R J Zagursky, D Shlaes, S J Projan
Transcription profiling-based identification of Staphylococcus aureus genes regulated by the agr and/or sarA loci.
J Bacteriol: 2001, 183(24);7341-53
[PubMed:11717293] [WorldCat.org] [DOI] (P p)Jon S Blevins, Karen E Beenken, Mohamed O Elasri, Barry K Hurlburt, Mark S Smeltzer
Strain-dependent differences in the regulatory roles of sarA and agr in Staphylococcus aureus.
Infect Immun: 2002, 70(2);470-80
[PubMed:11796572] [WorldCat.org] [DOI] (P p)Jaione Valle, Alejandro Toledo-Arana, Carmen Berasain, Jean-Marc Ghigo, Beatriz Amorena, José R Penadés, Iñigo Lasa
SarA and not sigmaB is essential for biofilm development by Staphylococcus aureus.
Mol Microbiol: 2003, 48(4);1075-87
[PubMed:12753197] [WorldCat.org] [DOI] (P p)Jutta Rossi, Markus Bischoff, Akihito Wada, Brigitte Berger-Bächi
MsrR, a putative cell envelope-associated element involved in Staphylococcus aureus sarA attenuation.
Antimicrob Agents Chemother: 2003, 47(8);2558-64
[PubMed:12878519] [WorldCat.org] [DOI] (P p)Lindsey Shaw, Ewa Golonka, Jan Potempa, Simon J Foster
The role and regulation of the extracellular proteases of Staphylococcus aureus.
Microbiology (Reading): 2004, 150(Pt 1);217-228
[PubMed:14702415] [WorldCat.org] [DOI] (P p)Jessica O O'Leary, Mark J Langevin, Christopher T D Price, Jon S Blevins, Mark S Smeltzer, John E Gustafson
Effects of sarA inactivation on the intrinsic multidrug resistance mechanism of Staphylococcus aureus.
FEMS Microbiol Lett: 2004, 237(2);297-302
[PubMed:15321676] [WorldCat.org] [DOI] (P p)Balakrishnan Prithiviraj, Harsh P Bais, Ajay K Jha, Jorge M Vivanco
Staphylococcus aureus pathogenicity on Arabidopsis thaliana is mediated either by a direct effect of salicylic acid on the pathogen or by SA-dependent, NPR1-independent host responses.
Plant J: 2005, 42(3);417-32
[PubMed:15842626] [WorldCat.org] [DOI] (P p)María Pilar Trotonda, Adhar C Manna, Ambrose L Cheung, Iñigo Lasa, José R Penadés
SarA positively controls bap-dependent biofilm formation in Staphylococcus aureus.
J Bacteriol: 2005, 187(16);5790-8
[PubMed:16077127] [WorldCat.org] [DOI] (P p)A L Cheung, S J Projan
Cloning and sequencing of sarA of Staphylococcus aureus, a gene required for the expression of agr.
J Bacteriol: 1994, 176(13);4168-72
[PubMed:8021198] [WorldCat.org] [DOI] (P p)M G Bayer, J H Heinrichs, A L Cheung
The molecular architecture of the sar locus in Staphylococcus aureus.
J Bacteriol: 1996, 178(15);4563-70
[PubMed:8755885] [WorldCat.org] [DOI] (P p)Y Chien, A L Cheung
Molecular interactions between two global regulators, sar and agr, in Staphylococcus aureus.
J Biol Chem: 1998, 273(5);2645-52
[PubMed:9446568] [WorldCat.org] [DOI] (P p)

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_00620&oldid=94291"