Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0790 [new locus tag: NWMN_RS04470 ]
- pan locus tag?: SAUPAN003014000
- symbol: NWMN_0790
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0790 [new locus tag: NWMN_RS04470 ]
- symbol: NWMN_0790
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 880276..880590
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332518 NCBI
- RefSeq: YP_001331824 NCBI
- BioCyc:
- MicrobesOnline: 3706339 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTATTTTGTTTTAGCAATATTTACAATAATCAGTGCCAGTGTAAGTTTAGGTTATTCA
ATTCAAGCATGTGCATCTAGCCATAATATAAATGCATATTATGCACTTAGTCGAAGCTTA
CCTTTATTTTTATTAGCTATTTTTTCTTTAGTCATTCATAGTGCTATATTTTTGATAACT
ATATCCATTGCAATGATCTTAGTTCAATTTTTAGATGCGATTGTTGGTTATAAAAGTGAA
GATGTCTTTAAAACTTATGGTCCATTAGCAACATCTGTAGTGAACTTAATATTATTAATA
GTTTTCTTATTTTAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0790 [new locus tag: NWMN_RS04470 ]
- symbol: NWMN_0790
- description: hypothetical protein
- length: 104
- theoretical pI: 7.50298
- theoretical MW: 11415.6
- GRAVY: 1.39712
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined PIRT; Phosphoinositide-interacting protein family (PF15099; HMM-score: 14.7)and 2 moreDUF996; Protein of unknown function (DUF996) (PF06195; HMM-score: 11.5)YtpI; YtpI-like protein (PF14007; HMM-score: 8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: 1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: Signal peptide LIPO(Sec/SPII) length 23 aa
- SP(Sec/SPI): 0.020046
- TAT(Tat/SPI): 0.001283
- LIPO(Sec/SPII): 0.780004
- Cleavage Site: CS pos: 23-24. IQA-CA. Pr: 0.7588
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MYFVLAIFTIISASVSLGYSIQACASSHNINAYYALSRSLPLFLLAIFSLVIHSAIFLITISIAMILVQFLDAIVGYKSEDVFKTYGPLATSVVNLILLIVFLF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]