From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1177 [new locus tag: NWMN_RS06640 ]
  • pan locus tag?: SAUPAN003569000
  • symbol: rpl7AE
  • pan gene symbol?: rplGA
  • synonym:
  • product: ribosomal protein L7Ae

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1177 [new locus tag: NWMN_RS06640 ]
  • symbol: rpl7AE
  • product: ribosomal protein L7Ae
  • replicon: chromosome
  • strand: +
  • coordinates: 1296046..1296363
  • length: 318
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAGTATAGATCAAATATTAAACTTTTTAGGATTAGCAATGAGAGCTGGTAAAGTAAAA
    ACAGGTGAATCAGTCATTGTTAATGAGATTAAAAAAGGAAATTTGAAGCTCGTTATTGTT
    GCAAATGATGCGTCTGATAATACAGCTAAATTAATTACAGATAAATGTAAGAGTTACAAA
    GTTCCATTCAGAAAGTTTGGAAATCGAAATGAATTGGGAATAGCACTTGGAAAAGGTGAG
    CGTGTTAATGTAGGGATTACTGACCCAGGCTTTGCTAAAAAGTTGCTATCAATGATAGAT
    GAATATCATAAGGAGTGA
    60
    120
    180
    240
    300
    318


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_1177 [new locus tag: NWMN_RS06640 ]
  • symbol: Rpl7AE
  • description: ribosomal protein L7Ae
  • length: 105
  • theoretical pI: 10.2152
  • theoretical MW: 11537.4
  • GRAVY: -0.207619

⊟Function[edit | edit source]

  • TIGRFAM:
    ribosomal protein eL8 (TIGR03677; HMM-score: 33.8)
    and 1 more
    Genetic information processing Protein synthesis tRNA aminoacylation D-tyrosyl-tRNA(Tyr) deacylase (TIGR00256; EC 3.6.1.-; HMM-score: 13.7)
  • TheSEED  :
    • Ribosomal protein L7Ae family protein YlxQ
    RNA Metabolism Transcription Transcription factors bacterial  ribosomal protein L7Ae family protein
  • PFAM:
    PELOTA (CL0101) Ribosomal_L7Ae; Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248; HMM-score: 53.6)
    and 2 more
    no clan defined Tyr_Deacylase; D-Tyr-tRNA(Tyr) deacylase (PF02580; HMM-score: 13.9)
    GT-A (CL0110) Glycos_transf_2; Glycosyl transferase family 2 (PF00535; HMM-score: 12.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9533
    • Cytoplasmic Membrane Score: 0.0014
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0453
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.023325
    • TAT(Tat/SPI): 0.001962
    • LIPO(Sec/SPII): 0.004847
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDASDNTAKLITDKCKSYKVPFRKFGNRNELGIALGKGERVNVGITDPGFAKKLLSMIDEYHKE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]