Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001240 [new locus tag: EGJ38_RS06195 ]
- pan locus tag?: SAUPAN003569000
- symbol: rplGA
- pan gene symbol?: rplGA
- synonym:
- alternate name: JSNZ_001240
- product: YlxQ family RNA-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001240 [new locus tag: EGJ38_RS06195 ]
- symbol: rplGA
- product: YlxQ family RNA-binding protein
- replicon: chromosome
- strand: +
- coordinates: 1250685..1251002
- length: 318
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423205 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAGTATAGATCAAATATTAAACTTTTTAGGATTAGCAATGAGAGCTGGTAAAGTAAAA
ACAGGTGAATCAGTCATTGTTAATGAGATTAAAAAAGGAAATTTGAAGCTCGTTATTGTT
GCAAATGATGCGTCTGATAATACAGCTAAATTAATTACAGATAAATGTAAGAGTTACAAA
GTTCCATTCAGAAAGTTTGGAAATCGAAATGAATTGGGAATAGCACTTGGAAAAGGTGAG
CGTGTTAATGTAGGGATTACTGACCCAGGCTTTGCTAAAAAGTTGCTATCAATGATAGAT
GAATATCATAAGGAGTGA60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001240 [new locus tag: EGJ38_RS06195 ]
- symbol: RplGA
- description: YlxQ family RNA-binding protein
- length: 105
- theoretical pI: 10.2152
- theoretical MW: 11537.4
- GRAVY: -0.207619
⊟Function[edit | edit source]
- TIGRFAM: ribosomal protein eL8 (TIGR03677; HMM-score: 33.8)and 1 moreProtein synthesis tRNA aminoacylation D-tyrosyl-tRNA(Tyr) deacylase (TIGR00256; EC 3.6.1.-; HMM-score: 13.7)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: PELOTA (CL0101) Ribosomal_L7Ae; Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248; HMM-score: 53.6)and 2 moreno clan defined Tyr_Deacylase; D-Tyr-tRNA(Tyr) deacylase (PF02580; HMM-score: 13.9)GT-A (CL0110) Glycos_transf_2; Glycosyl transferase family 2 (PF00535; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9533
- Cytoplasmic Membrane Score: 0.0014
- Cell wall & surface Score: 0
- Extracellular Score: 0.0453
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.023325
- TAT(Tat/SPI): 0.001962
- LIPO(Sec/SPII): 0.004847
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423205 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDASDNTAKLITDKCKSYKVPFRKFGNRNELGIALGKGERVNVGITDPGFAKKLLSMIDEYHKE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)