From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS06195 [old locus tag: EGJ38_001240 ]
  • pan locus tag?: SAUPAN003569000
  • symbol: EGJ38_RS06195
  • pan gene symbol?: rplGA
  • synonym:
  • product: YlxQ family RNA-binding protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS06195 [old locus tag: EGJ38_001240 ]
  • symbol: EGJ38_RS06195
  • product: YlxQ family RNA-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1250685..1251002
  • length: 318
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (1250685..1251002) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAGTATAGATCAAATATTAAACTTTTTAGGATTAGCAATGAGAGCTGGTAAAGTAAAA
    ACAGGTGAATCAGTCATTGTTAATGAGATTAAAAAAGGAAATTTGAAGCTCGTTATTGTT
    GCAAATGATGCGTCTGATAATACAGCTAAATTAATTACAGATAAATGTAAGAGTTACAAA
    GTTCCATTCAGAAAGTTTGGAAATCGAAATGAATTGGGAATAGCACTTGGAAAAGGTGAG
    CGTGTTAATGTAGGGATTACTGACCCAGGCTTTGCTAAAAAGTTGCTATCAATGATAGAT
    GAATATCATAAGGAGTGA
    60
    120
    180
    240
    300
    318


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS06195 [old locus tag: EGJ38_001240 ]
  • symbol: EGJ38_RS06195
  • description: YlxQ family RNA-binding protein
  • length: 105
  • theoretical pI: 10.2152
  • theoretical MW: 11537.4
  • GRAVY: -0.207619

Function[edit | edit source]

  • TIGRFAM:
    ribosomal protein eL8 (TIGR03677; HMM-score: 33.8)
    and 1 more
    Genetic information processing Protein synthesis tRNA aminoacylation D-tyrosyl-tRNA(Tyr) deacylase (TIGR00256; EC 3.6.1.-; HMM-score: 13.7)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    PELOTA (CL0101) Ribosomal_L7Ae; Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248; HMM-score: 53.6)
    and 2 more
    no clan defined Tyr_Deacylase; D-Tyr-tRNA(Tyr) deacylase (PF02580; HMM-score: 13.9)
    GT-A (CL0110) Glycos_transf_2; Glycosyl transferase family 2 (PF00535; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9533
    • Cytoplasmic Membrane Score: 0.0014
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0453
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.023325
    • TAT(Tat/SPI): 0.001962
    • LIPO(Sec/SPII): 0.004847
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000020853 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSIDQILNFLGLAMRAGKVKTGESVIVNEIKKGNLKLVIVANDASDNTAKLITDKCKSYKVPFRKFGNRNELGIALGKGERVNVGITDPGFAKKLLSMIDEYHKE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]