From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1356 [new locus tag: NWMN_RS07645 ]
  • pan locus tag?: SAUPAN003904000
  • symbol: NWMN_1356
  • pan gene symbol?: gpsB
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1356 [new locus tag: NWMN_RS07645 ]
  • symbol: NWMN_1356
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1521970..1522314
  • length: 345
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTCAGATGTTTCATTGAAATTATCAGCAAAAGATATTTATGAAAAAGATTTTGAAAAA
    ACGATGGCTCGTGGCTATAGAAGAGAAGAAGTAGATGCATTTTTAGATGACATTATTGCT
    GATTATCAAAAAATGGCCGATATGAATAATGAAGTTGTAAAATTATCAGAAGAGAATCAT
    AAACTTAAAAAAGAATTAGAAGAATTAAGACTACGTGTAGCAACATCAAGACCTCAGGAC
    AATAAAAGTTTTTCTTCGAATAATACAACAACAAATACATCTTCAAATAATGTAGATATT
    TTAAAACGTATTTCAAACTTAGAAAAAGCTGTATTTGGTAAATAA
    60
    120
    180
    240
    300
    345


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_1356 [new locus tag: NWMN_RS07645 ]
  • symbol: NWMN_1356
  • description: hypothetical protein
  • length: 114
  • theoretical pI: 5.97468
  • theoretical MW: 13150.7
  • GRAVY: -0.867544

⊟Function[edit | edit source]

  • TIGRFAM:
    DivIVA domain (TIGR03544; HMM-score: 52.8)
    and 4 more
    Cellular processes Cellular processes Sporulation and germination transcription factor, RsfA family (TIGR02894; HMM-score: 16.8)
    Signal transduction Regulatory functions DNA interactions transcription factor, RsfA family (TIGR02894; HMM-score: 16.8)
    DivIVA domain repeat protein (TIGR03543; HMM-score: 16.1)
    SH3 domain protein (TIGR04211; HMM-score: 13.5)
  • TheSEED  :
    • Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Control of cell elongation - division cycle in Bacilli  Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1
  • PFAM:
    no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 43.5)
    and 19 more
    YabA; Initiation control protein YabA (PF06156; HMM-score: 24.9)
    HMMR_C; Hyaluronan mediated motility receptor C-terminal (PF15908; HMM-score: 20)
    Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 18)
    bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 16.7)
    no clan defined DASH_Spc19; Spc19 (PF08287; HMM-score: 16.6)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 16.5)
    Kre28-like_sf (CL0729) Sos7; Kinetochore protein Sos7 (PF20882; HMM-score: 16.3)
    no clan defined TssO; Type VI secretion system, TssO (PF17561; HMM-score: 15.6)
    HALZ; Homeobox associated leucine zipper (PF02183; HMM-score: 15)
    SlyX; SlyX (PF04102; HMM-score: 14.9)
    Ribo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 14)
    no clan defined Cnn_1N; Centrosomin N-terminal motif 1 (PF07989; HMM-score: 13.9)
    TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 13.6)
    TMCO5; TMCO5 family (PF14992; HMM-score: 13.5)
    DUF2797; Protein of unknown function (DUF2797) (PF10977; HMM-score: 13.1)
    TPR (CL0020) FAN1_TPR; Fanconi-associated nuclease 1, TPR domain (PF21170; HMM-score: 13.1)
    no clan defined ABC_tran_CTD; ABC transporter C-terminal domain (PF16326; HMM-score: 12.1)
    bZIP (CL0018) bZIP_2; Basic region leucine zipper (PF07716; HMM-score: 11.4)
    no clan defined Herpes_BLRF2; Herpesvirus BLRF2 protein (PF05812; HMM-score: 11.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9708
    • Cytoplasmic Membrane Score: 0.0155
    • Cell wall & surface Score: 0.0027
    • Extracellular Score: 0.011
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001477
    • TAT(Tat/SPI): 0.000385
    • LIPO(Sec/SPII): 0.000377
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]