Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1484 [new locus tag: SACOL_RS07565 ]
- pan locus tag?: SAUPAN003904000
- symbol: SACOL1484
- pan gene symbol?: gpsB
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1484 [new locus tag: SACOL_RS07565 ]
- symbol: SACOL1484
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1525790..1526134
- length: 345
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236286 NCBI
- RefSeq: YP_186329 NCBI
- BioCyc:
- MicrobesOnline: 912937 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTCAGATGTTTCATTGAAATTATCAGCAAAAGATATTTATGAAAAAGATTTTGAAAAA
ACGATGGCTCGTGGCTATAGAAGAGAAGAAGTAGATGCATTTTTAGATGACATTATTGCT
GATTATCAAAAAATGGCCGATATGAATAATGAAGTTGTAAAATTATCAGAAGAGAATCAT
AAACTTAAAAAAGAATTAGAAGAATTAAGACTACGTGTAGCAACATCAAGACCTCAGGAC
AATAAAAGTTTTTCTTCGAATAATACAACAACAAATACATCTTCAAATAATGTAGATATT
TTAAAACGTATTTCAAACTTAGAAAAAGCTGTATTTGGTAAATAA60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1484 [new locus tag: SACOL_RS07565 ]
- symbol: SACOL1484
- description: hypothetical protein
- length: 114
- theoretical pI: 5.97468
- theoretical MW: 13150.7
- GRAVY: -0.867544
⊟Function[edit | edit source]
- TIGRFAM: DivIVA domain (TIGR03544; HMM-score: 52.8)and 4 moreCellular processes Sporulation and germination transcription factor, RsfA family (TIGR02894; HMM-score: 16.8)Regulatory functions DNA interactions transcription factor, RsfA family (TIGR02894; HMM-score: 16.8)DivIVA domain repeat protein (TIGR03543; HMM-score: 16.1)SH3 domain protein (TIGR04211; HMM-score: 13.5)
- TheSEED:
- PFAM: no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 45.9)and 19 moreYabB; Initiation control protein YabA (PF06156; HMM-score: 24.9)HMMR_C; Hyaluronan mediated motility receptor C-terminal (PF15908; HMM-score: 19.7)Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 18.9)bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 16.7)no clan defined HOOK; HOOK protein (PF05622; HMM-score: 16.3)CtIP_N; Tumour-suppressor protein CtIP N-terminal domain (PF10482; HMM-score: 15.8)FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 15.7)no clan defined ABC_tran_CTD; ABC transporter C-terminal domain (PF16326; HMM-score: 15)DASH_Spc19; Spc19 (PF08287; HMM-score: 14.9)HALZ; Homeobox associated leucine zipper (PF02183; HMM-score: 14.7)SlyX; SlyX (PF04102; HMM-score: 14.5)CENP-H; Centromere protein H (CENP-H) (PF05837; HMM-score: 14.2)Ribo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 13.8)no clan defined TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 13.7)bZIP (CL0018) bZIP_2; Basic region leucine zipper (PF07716; HMM-score: 13.3)no clan defined Cnn_1N; Centrosomin N-terminal motif 1 (PF07989; HMM-score: 12.5)IncA; IncA protein (PF04156; HMM-score: 12.3)Herpes_BLRF2; Herpesvirus BLRF2 protein (PF05812; HMM-score: 12)CC2-LZ; Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator (PF16516; HMM-score: 10.1)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001477
- TAT(Tat/SPI): 0.000385
- LIPO(Sec/SPII): 0.000377
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlasquantitative data / protein copy number per cell: 1659 [6]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 10.27 h [7]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
Profiling the surfacome of Staphylococcus aureus.
Proteomics: 2010, 10(17);3082-96
[PubMed:20662103] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]