Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1446 [new locus tag: NWMN_RS08160 ]
- pan locus tag?: SAUPAN004121000
- symbol: NWMN_1446
- pan gene symbol?: comGC
- synonym:
- product: competence protein ComGC-like protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1446 [new locus tag: NWMN_RS08160 ]
- symbol: NWMN_1446
- product: competence protein ComGC-like protein
- replicon: chromosome
- strand: -
- coordinates: 1614748..1615059
- length: 312
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330860 NCBI
- RefSeq: YP_001332480 NCBI
- BioCyc:
- MicrobesOnline: 3706998 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTA
TTAATCATCAGTTTATTATTAATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCAC
ATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTAATAGTCAAATTGAAGCGTAT
GCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCA
GTTGCAAATTAG60
120
180
240
300
312
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1446 [new locus tag: NWMN_RS08160 ]
- symbol: NWMN_1446
- description: competence protein ComGC-like protein
- length: 103
- theoretical pI: 8.76209
- theoretical MW: 11315.3
- GRAVY: 0.283495
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Pathogenesis type II secretion system protein G (TIGR01710; HMM-score: 41.8)Protein fate Protein and peptide secretion and trafficking type II secretion system protein G (TIGR01710; HMM-score: 41.8)and 7 moreCell envelope Surface structures Verru_Chthon cassette protein D (TIGR02596; HMM-score: 24.9)Cellular processes Pathogenesis type II secretion system protein H (TIGR01708; HMM-score: 20.2)Protein fate Protein and peptide secretion and trafficking type II secretion system protein H (TIGR01708; HMM-score: 20.2)Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 20.1)Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 20.1)Cell envelope Surface structures Verru_Chthon cassette protein C (TIGR02599; HMM-score: 16.7)type II secretion system protein I (TIGR01707; HMM-score: 11.5)
- TheSEED :
- Late competence protein ComGC, access of DNA to ComEA, FIG007487
- PFAM: no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 23.9)and 6 moreHTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 15)no clan defined SecD-TM1; SecD export protein N-terminal TM region (PF13721; HMM-score: 14.3)SHP; Small hydrophobic protein (PF03579; HMM-score: 13.5)DMT (CL0184) DUF5989; Family of unknown function (DUF5989) (PF19451; HMM-score: 13)no clan defined Ecm33; GPI-anchored cell wall organization protein (PF12454; HMM-score: 11.4)Tad-like (CL0496) TadF; Putative tight adherence pilin protein F (PF16964; HMM-score: 10.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cellwall
- Cytoplasmic Score: 0.11
- Cytoplasmic Membrane Score: 0.93
- Cellwall Score: 8.19
- Extracellular Score: 0.77
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0006
- Cytoplasmic Membrane Score: 0.9769
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0224
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.25928
- TAT(Tat/SPI): 0.002582
- LIPO(Sec/SPII): 0.008511
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFIKEAQKTCKSGETITISNGEAVAN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: NWMN_1443 < NWMN_1444 < NWMN_1445 < NWMN_1446 < NWMN_1447 < NWMN_1448 < NWMN_1449 < NWMN_1450 < glk
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]