From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1372 [new locus tag: SA_RS07765 ]
  • pan locus tag?: SAUPAN004121000
  • symbol: SA1372
  • pan gene symbol?: comGC
  • synonym:
  • product: exogenous DNA-binding protein comGC

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1372 [new locus tag: SA_RS07765 ]
  • symbol: SA1372
  • product: exogenous DNA-binding protein comGC
  • replicon: chromosome
  • strand: -
  • coordinates: 1578832..1579143
  • length: 312
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTA
    TTAATCATCAGTTTATTATTAATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCAC
    ATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTAATAGTCAAATTGAAGCGTAT
    GCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
    AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCA
    GTTGCAAATTAG
    60
    120
    180
    240
    300
    312


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1372 [new locus tag: SA_RS07765 ]
  • symbol: SA1372
  • description: exogenous DNA-binding protein comGC
  • length: 103
  • theoretical pI: 8.76209
  • theoretical MW: 11315.3
  • GRAVY: 0.283495

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis type II secretion system protein G (TIGR01710; HMM-score: 41.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein G (TIGR01710; HMM-score: 41.8)
    and 7 more
    Cell structure Cell envelope Surface structures Verru_Chthon cassette protein D (TIGR02596; HMM-score: 24.9)
    Cellular processes Cellular processes Pathogenesis type II secretion system protein H (TIGR01708; HMM-score: 20.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein H (TIGR01708; HMM-score: 20.2)
    Cell structure Cell envelope Surface structures prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 20.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking prepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 20.1)
    Cell structure Cell envelope Surface structures Verru_Chthon cassette protein C (TIGR02599; HMM-score: 16.7)
    type II secretion system protein I (TIGR01707; HMM-score: 11.5)
  • TheSEED  :
    • Late competence protein ComGC, access of DNA to ComEA, FIG007487
    DNA Metabolism DNA uptake, competence Late competence  Late competence protein ComGC, access of DNA to ComEA, FIG007487
  • PFAM:
    no clan defined N_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 23.9)
    and 6 more
    HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 15)
    no clan defined SecD-TM1; SecD export protein N-terminal TM region (PF13721; HMM-score: 14.3)
    SHP; Small hydrophobic protein (PF03579; HMM-score: 13.5)
    DMT (CL0184) DUF5989; Family of unknown function (DUF5989) (PF19451; HMM-score: 13)
    no clan defined Ecm33; GPI-anchored cell wall organization protein (PF12454; HMM-score: 11.4)
    Tad-like (CL0496) TadF; Putative tight adherence pilin protein F (PF16964; HMM-score: 10.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.11
    • Cytoplasmic Membrane Score: 0.93
    • Cellwall Score: 8.19
    • Extracellular Score: 0.77
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0006
    • Cytoplasmic Membrane Score: 0.9769
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0224
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.25928
    • TAT(Tat/SPI): 0.002582
    • LIPO(Sec/SPII): 0.008511
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFIKEAQKTCKSGETITISNGEAVAN

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigH* regulon
    SigH*(sigma factor)controlling competence and phage integrase genes;  [1]   other strains

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Kazuya Morikawa, Yumiko Inose, Hideyuki Okamura, Atsushi Maruyama, Hideo Hayashi, Kunio Takeyasu, Toshiko Ohta
    A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes.
    Genes Cells: 2003, 8(8);699-712
    [PubMed:12875655] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]