Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1494 [new locus tag: NWMN_RS08410 ]
- pan locus tag?: SAUPAN004178000
- symbol: NWMN_1494
- pan gene symbol?: rsfS
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1494 [new locus tag: NWMN_RS08410 ]
- symbol: NWMN_1494
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1662436..1662789
- length: 354
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330888 NCBI
- RefSeq: YP_001332528 NCBI
- BioCyc:
- MicrobesOnline: 3707046 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATTCACAAGAATTATTAGCAATTGCTGTGGATGCAATTGACAATAAAAAAGGCGAA
GATACGATTTCTTTAGAAATGAAAGGTATCAGCGATATGACAGATTATTTTGTTGTAACG
CACGGAAATAATGAACGACAAGTTCAAGCGATTGCTAGAGCGGTGAAAGAAGTAGCCAAT
GAACAAAATATAGAAGTAAAACGTATGGAAGGATACAATGAAGCGCGTTGGATATTAATT
GACTTAGCTGATGTTGTGGTACATGTTTTCCATAAAGACGAAAGAAATTATTATAATATT
GAAAAGTTATATCAAGATGCACCATTAGAATCATATAGTCAGGTTGCGTATTAA60
120
180
240
300
354
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1494 [new locus tag: NWMN_RS08410 ]
- symbol: NWMN_1494
- description: hypothetical protein
- length: 117
- theoretical pI: 4.42783
- theoretical MW: 13482
- GRAVY: -0.463248
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Translation factors ribosome silencing factor (TIGR00090; HMM-score: 112.2)and 1 more[FeFe] hydrogenase, group A (TIGR02512; EC 1.12.-.-; HMM-score: 12.9)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: NTP_transf (CL0260) RsfS; Ribosomal silencing factor during starvation (PF02410; HMM-score: 83.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005488
- TAT(Tat/SPI): 0.000356
- LIPO(Sec/SPII): 0.001039
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNSQELLAIAVDAIDNKKGEDTISLEMKGISDMTDYFVVTHGNNERQVQAIARAVKEVANEQNIEVKRMEGYNEARWILIDLADVVVHVFHKDERNYYNIEKLYQDAPLESYSQVAY
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: holA < comEC < comEB < comEA < NWMN_1493 < NWMN_1494 < NWMN_1495 < NWMN_1496 < NWMN_1497 < aroE < NWMN_1499 < NWMN_1500 < pfs
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]