From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1610 [new locus tag: NWMN_RS09025 ]
  • pan locus tag?: SAUPAN004368000
  • symbol: NWMN_1610
  • pan gene symbol?: nifZ
  • synonym:
  • product: aminotransferase, class V

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1610 [new locus tag: NWMN_RS09025 ]
  • symbol: NWMN_1610
  • product: aminotransferase, class V
  • replicon: chromosome
  • strand: -
  • coordinates: 1787327..1788466
  • length: 1140
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    TTGATATATCTAGATAATGCGGCAACGACGAAAGCATTTGAAGAAGTGTTAGATACTTAT
    TTAAAAGTAAATCAATCAATGTATTATAATCCGAATAGTCCGCATAAAGCTGGTTTGCAG
    GCAAATCAATTACTACAACAAGCAAAAACCCAAATTAATGCAATGATTAATTCAAAAACA
    AATTATGATGTTGTATTCACTAGTGGTGCAACTGAATCCAATAATCTTGCTTTAAAAGGT
    ATTGCCTATCGTAAATTTGATACAGCGAAGGAAATAATTACATCCGTGTTAGAGCATCCG
    TCCGTATTAGAGGTTGTAAGATATTTGGAAGCACACGAAGGATTTAAAGTTAAATATGTT
    GATGTAAAGAAAGATGGCAGTATTAACTTAGAACACTTCAAAGAATTAATGTCAGACAAA
    GTCGGTTTAGTAACATGTATGTATGTAAATAATGTAACTGGACAAATACAGCCTATTCCA
    CAAATGGCTAAAGTTATAAAAAATTATCCTAAGGCACATTTTCATGTAGATGCGGTTCAA
    GCATTCGGCAAAATTTCAATGGATCTCAATAACATAGATAGTATTAGTTTAAGTGGACAC
    AAGTTTAATGGTTTAAAAGGACAAGGCGTCTTACTTGTAAATCACATTCAAAATGTTGAA
    CCAACTGTCCATGGTGGTGGTCAAGAATATGGCGTTAGAAGTGGAACAGTTAATTTGCCA
    AATGATATTGCAATGGTTAAAGCGATGAAGATAGCTAATGAAAACTTTGAAGCATTGAAT
    GCATTTGTTACTGAGTTAAATAATGACGTCCGTCAATTTTTAAATAAATATCATGGAGTT
    TATATTAATTCTTCAACTTCAGGTTCACCATTCGTTTTAAATATTAGTTTTCCTGGCGTA
    AAAGGTGAAGTATTAGTTAATGCTTTTTCAAAATATGACATTATGATATCTACGACAAGT
    GCTTGTTCATCTAAACGTAATAAATTAAATGAAGTATTGGCTGCAATGGGATTATCAGAC
    AAATCTATTGAAGGTAGTATAAGATTATCATTTGGGGCTACTACAACTAAAGAAGATATA
    GCGAGGTTTAAAGAAATATTTATCATCATTTATGAGGAAATTAAGGAGTTGCTAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_1610 [new locus tag: NWMN_RS09025 ]
  • symbol: NWMN_1610
  • description: aminotransferase, class V
  • length: 379
  • theoretical pI: 8.1916
  • theoretical MW: 41991.8
  • GRAVY: -0.156464

Function[edit | edit source]

  • TIGRFAM:
    cysteine desulfurase NifS (TIGR03402; EC 2.8.1.7; HMM-score: 310.8)
    Genetic information processing DNA metabolism Restriction/modification cysteine desulfurase DndA (TIGR03235; EC 2.8.1.7; HMM-score: 297.6)
    Genetic information processing Protein synthesis tRNA and rRNA base modification cysteine desulfurase IscS (TIGR02006; EC 2.8.1.7; HMM-score: 281.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other cysteine desulfurase IscS (TIGR02006; EC 2.8.1.7; HMM-score: 281.6)
    cysteine desulfurase, NifS family (TIGR03403; EC 2.8.1.7; HMM-score: 250.1)
    and 7 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other cysteine desulfurase, SufS family (TIGR01979; HMM-score: 139)
    Unknown function Enzymes of unknown specificity cysteine desulfurase family protein (TIGR01977; HMM-score: 132.1)
    Unknown function Enzymes of unknown specificity cysteine desulfurase family protein (TIGR01976; HMM-score: 86.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other cysteine desulfurase, catalytic subunit CsdA (TIGR03392; EC 2.8.1.7; HMM-score: 76.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs ergothioneine biosynthesis PLP-dependent enzyme EgtE (TIGR04343; EC 4.4.-.-; HMM-score: 43.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other tyrosine decarboxylase MnfA (TIGR03812; EC 4.1.1.25; HMM-score: 28)
    Metabolism Central intermediary metabolism Phosphorus compounds 2-aminoethylphosphonate--pyruvate transaminase (TIGR02326; EC 2.6.1.37; HMM-score: 25.4)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    PLP_aminotran (CL0061) Aminotran_5; Aminotransferase class-V (PF00266; HMM-score: 236.1)
    and 4 more
    DegT_DnrJ_EryC1; DegT/DnrJ/EryC1/StrS aminotransferase family (PF01041; HMM-score: 19.8)
    EF_hand (CL0220) EF-hand_1; EF hand (PF00036; HMM-score: 15.8)
    PLP_aminotran (CL0061) Beta_elim_lyase; Beta-eliminating lyase (PF01212; HMM-score: 15.6)
    no clan defined DUF4473; Domain of unknown function (DUF4473) (PF14747; HMM-score: 8.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: pyridoxal 5'-phosphate
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012625
    • TAT(Tat/SPI): 0.000704
    • LIPO(Sec/SPII): 0.001154
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQINAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEAHEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPKAHFHVDAVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYGVRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPFVLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDIARFKEIFIIIYEEIKELLK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]