From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1879 [new locus tag: NWMN_RS15465 ]
  • pan locus tag?: SAUPAN005025000
  • symbol: NWMN_1879
  • pan gene symbol?: truncated lytA
  • synonym:
  • product: truncated phage amidase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1879 [new locus tag: NWMN_RS15465 ]
  • symbol: NWMN_1879
  • product: truncated phage amidase
  • replicon: chromosome
  • strand: -
  • coordinates: 2091215..2091469
  • length: 255
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGATATCCTTTTTGCCCTTCACTCGATACATATATCTCAACAACATAGAAATATTACAG
    TCGCTACACCGCATCTTAAATGGTGTGGTTATTTTTATTGGAAGTGTGTATCAGGTATCA
    GTAATGTTAAAACACCAGCTAAAAATGAAAAGAATTCACCAGTGCCAGCAGGTTATACAC
    TCGATAAAAACAATGTACCGTATAAAAAAGAGACTGGTTATTACACAGTTGCCAATGTTA
    AAGGTAATAACGTGA
    60
    120
    180
    240
    255

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_1879 [new locus tag: NWMN_RS15465 ]
  • symbol: NWMN_1879
  • description: truncated phage amidase
  • length: 84
  • theoretical pI: 11.2121
  • theoretical MW: 10010.2
  • GRAVY: 0.397619

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for N315
  • PFAM:
    SH3 (CL0010) Gemin6; Gemin6 Sm-like domain (PF06372; HMM-score: 13.4)
    no clan defined DUF1667; Protein of unknown function (DUF1667) (PF07892; HMM-score: 13.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7445
    • Cytoplasmic Membrane Score: 0.0752
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.18
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003588
    • TAT(Tat/SPI): 0.000311
    • LIPO(Sec/SPII): 0.000758
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MISFLPFTRYIYLNNIEILQSLHRILNGVVIFIGSVYQVSVMLKHQLKMKRIHQCQQVIHSIKTMYRIKKRLVITQLPMLKVIT

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]