Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1944 [new locus tag: NWMN_RS11215 ]
- pan locus tag?: SAUPAN005276000
- symbol: agrD
- pan gene symbol?: agrD
- synonym:
- product: accessory gene regulator protein D
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1944 [new locus tag: NWMN_RS11215 ]
- symbol: agrD
- product: accessory gene regulator protein D
- replicon: chromosome
- strand: +
- coordinates: 2152087..2152227
- length: 141
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331720 NCBI
- RefSeq: YP_001332978 NCBI
- BioCyc:
- MicrobesOnline: 3707532 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAATACATTATTTAACTTATTTTTTGATTTTATTACTGGGATTTTAAAAAACATTGGT
AACATCGCAGCTTATAGTACTTGTGACTTCATAATGGATGAAGTTGAAGTACCAAAAGAA
TTAACACAATTACACGAATAA60
120
141
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1944 [new locus tag: NWMN_RS11215 ]
- symbol: AgrD
- description: accessory gene regulator protein D
- length: 46
- theoretical pI: 3.96381
- theoretical MW: 5297.07
- GRAVY: 0.293478
⊟Function[edit | edit source]
- TIGRFAM: cyclic lactone autoinducer peptide (TIGR04223; HMM-score: 33.2)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: no clan defined AgrD; Staphylococcal AgrD protein (PF05931; HMM-score: 95.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.09954
- TAT(Tat/SPI): 0.007564
- LIPO(Sec/SPII): 0.117094
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNTLFNLFFDFITGILKNIGNIAAYSTCDFIMDEVEVPKELTQLHE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: agrB > agrD > agrC > agrA
⊟Regulation[edit | edit source]
- regulators: AgrA (activation) regulon, CodY (repression) regulon
AgrA (TF) important in Virulence, Quorum sensing; transcription unit transferred from N315 data RegPrecise CodY (TF) important in Amino acid metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.