Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS066 [new locus tag: SA_RS10575 ]
- pan locus tag?: SAUPAN005276000
- symbol: agrD
- pan gene symbol?: agrD
- synonym:
- product: AgrD protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS066 [new locus tag: SA_RS10575 ]
- symbol: agrD
- product: AgrD protein
- replicon: chromosome
- strand: +
- coordinates: 2080012..2080155
- length: 144
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124736 NCBI
- RefSeq: NP_375145 NCBI
- BioCyc: see SA_RS10575
- MicrobesOnline: 104171 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAATACACTTGTTAATATGTTTTTTGATTTTATAATTAAATTAGCTAAAGCAATCGGA
ATTGTCGGTGGCGTAAACGCTTGCAGCAGTTTATTTGATGAACCTAAAGTACCCGCTGAA
TTAACGAATTTATACGACAAATAG60
120
144
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS066 [new locus tag: SA_RS10575 ]
- symbol: AgrD
- description: AgrD protein
- length: 47
- theoretical pI: 4.63622
- theoretical MW: 5149.04
- GRAVY: 0.482979
⊟Function[edit | edit source]
- TIGRFAM: cyclic lactone autoinducer peptide (TIGR04223; HMM-score: 35.2)
- TheSEED :
- Accessory gene regulator D (pheromone precursor, type III)
- PFAM: no clan defined AgrD; Staphylococcal AgrD protein (PF05931; HMM-score: 56.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0012
- Cytoplasmic Membrane Score: 0.3976
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.6011
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.67
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: Signal peptide LIPO(Sec/SPII) length 27 aa
- SP(Sec/SPI): 0.042942
- TAT(Tat/SPI): 0.024222
- LIPO(Sec/SPII): 0.877376
- Cleavage Site: CS pos: 27-28. VNA-CS. Pr: 0.8875
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNTLVNMFFDFIIKLAKAIGIVGGVNACSSLFDEPKVPAELTNLYDK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: AgrA (activation) regulon, CodY (repression) regulon
AgrA (TF) important in Virulence, Quorum sensing; RegPrecise CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]