From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10575 [old locus tag: SAS066 ]
  • pan locus tag?: SAUPAN005276000
  • symbol: SA_RS10575
  • pan gene symbol?: agrD
  • synonym:
  • product: cyclic lactone autoinducer peptide

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS10575 [old locus tag: SAS066 ]
  • symbol: SA_RS10575
  • product: cyclic lactone autoinducer peptide
  • replicon: chromosome
  • strand: +
  • coordinates: 2080012..2080155
  • length: 144
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (2080012..2080155) NCBI
  • BioCyc: SA_RS10575 BioCyc
  • MicrobesOnline: see SAS066

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAATACACTTGTTAATATGTTTTTTGATTTTATAATTAAATTAGCTAAAGCAATCGGA
    ATTGTCGGTGGCGTAAACGCTTGCAGCAGTTTATTTGATGAACCTAAAGTACCCGCTGAA
    TTAACGAATTTATACGACAAATAG
    60
    120
    144


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS10575 [old locus tag: SAS066 ]
  • symbol: SA_RS10575
  • description: cyclic lactone autoinducer peptide
  • length: 47
  • theoretical pI: 4.63622
  • theoretical MW: 5149.04
  • GRAVY: 0.482979

Function[edit | edit source]

  • TIGRFAM:
    cyclic lactone autoinducer peptide (TIGR04223; HMM-score: 35.2)
  • TheSEED: see SAS066
  • PFAM:
    no clan defined AgrD; Staphylococcal AgrD protein (PF05931; HMM-score: 56.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0012
    • Cytoplasmic Membrane Score: 0.3976
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.6011
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 27 aa
    • SP(Sec/SPI): 0.042942
    • TAT(Tat/SPI): 0.024222
    • LIPO(Sec/SPII): 0.877376
    • Cleavage Site: CS pos: 27-28. VNA-CS. Pr: 0.8875
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MNTLVNMFFDFIIKLAKAIGIVGGVNACSSLFDEPKVPAELTNLYDK

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: AgrA, CodY see SAS066

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]