From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1990 [new locus tag: NWMN_RS11510 ]
  • pan locus tag?: SAUPAN005362000
  • symbol: NWMN_1990
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1990 [new locus tag: NWMN_RS11510 ]
  • symbol: NWMN_1990
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2212355..2212564
  • length: 210
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATACATCAAAATACGATTTACACAGCGGGAATTGAAACAGAAGAACAAGTAAGTCAA
    TTGACAGAACGCATTTCAAATATGATAGGTGTTCATCAAGTGAATATTAATATAATAGAT
    GGTCAAGTAACTGTATCGTATGAGACACCAGCAAATTTGAATAGTATTGAAAAAGAAATC
    TATGATGAAGGATACAAAATTGTATTTTAG
    60
    120
    180
    210

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_1990 [new locus tag: NWMN_RS11510 ]
  • symbol: NWMN_1990
  • description: hypothetical protein
  • length: 69
  • theoretical pI: 4.10098
  • theoretical MW: 7843.71
  • GRAVY: -0.224638

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper ion binding protein (TIGR00003; HMM-score: 25.7)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined HMA; Heavy-metal-associated domain (PF00403; HMM-score: 23.4)
    and 4 more
    NPHI_C; Nucleoside triphosphatase I C-terminal (PF08469; HMM-score: 14.1)
    Spore_YhcN_YlaJ; Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ) (PF09580; HMM-score: 14)
    Sialidase (CL0434) HN; Haemagglutinin-neuraminidase (PF00423; HMM-score: 13.7)
    no clan defined PAC1; Proteasome assembly chaperone 4 (PF16094; HMM-score: 12.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.0084
    • TAT(Tat/SPI): 0.000413
    • LIPO(Sec/SPII): 0.00082
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIHQNTIYTAGIETEEQVSQLTERISNMIGVHQVNINIIDGQVTVSYETPANLNSIEKEIYDEGYKIVF

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=NWMN_1990&oldid=69561"