From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1991 [new locus tag: NWMN_RS11515 ]
  • pan locus tag?: SAUPAN005363000
  • symbol: NWMN_1991
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_1991 [new locus tag: NWMN_RS11515 ]
  • symbol: NWMN_1991
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2212576..2212914
  • length: 339
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGGATATAGTATAGTAAGGAATGTAAATGAAGGAGTGAATGCTATGACTGAACAAGAT
    AATGCACATCATTCTGAACAAATAAAAACGAATCTTAAATCACGTTTAAATCGAATTGAA
    GGACAAGTGAGAGCGATTAATCGCATGATTGAAGAAGATGTCTATTGTGATGATGTCCTT
    ACGCAAATAAGAGCGACACGTTCGGCGTTAAACAGTGTTGCGATAAAGTTATTAGAACAA
    CATATGAAAAGTTGTATTATGAATAAAGTTAATCAAGGTGCTCAGGAAGAGGCAATGGAA
    GAGTTATTAGTGACTTTTCAAAAATTGATTAAAGACTAA
    60
    120
    180
    240
    300
    339

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_1991 [new locus tag: NWMN_RS11515 ]
  • symbol: NWMN_1991
  • description: hypothetical protein
  • length: 112
  • theoretical pI: 6.25313
  • theoretical MW: 12802.6
  • GRAVY: -0.480357

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage terminase, large subunit, PBSX family (TIGR01547; HMM-score: 15)
    Unknown function General zinc finger protein ZPR1 homolog (TIGR00340; HMM-score: 13.9)
    two transmembrane protein (TIGR04527; HMM-score: 12)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined Trns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 96.3)
    and 7 more
    Herpes_UL14; Herpesvirus UL14-like protein (PF03580; HMM-score: 15.6)
    RPM2; Mitochondrial ribonuclease P subunit (RPM2) (PF08579; HMM-score: 14.7)
    YojJ; Bacterial membrane-spanning protein N-terminus (PF10372; HMM-score: 14.4)
    AKAP95; A-kinase anchoring protein 95 (AKAP95) (PF04988; HMM-score: 13.8)
    DHR-2; Dock homology region 2 (PF06920; HMM-score: 13)
    DUF2175; Uncharacterized protein conserved in archaea (DUF2175) (PF09943; HMM-score: 11.4)
    LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 10.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006061
    • TAT(Tat/SPI): 0.000622
    • LIPO(Sec/SPII): 0.001076
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MGYSIVRNVNEGVNAMTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVLTQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQEEAMEELLVTFQKLIKD

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=NWMN_1991&oldid=70326"