Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2043 [new locus tag: NWMN_RS11800 ]
- pan locus tag?: SAUPAN005436000
- symbol: NWMN_2043
- pan gene symbol?: dps
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2043 [new locus tag: NWMN_RS11800 ]
- symbol: NWMN_2043
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2260655..2261098
- length: 444
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331859 NCBI
- RefSeq: YP_001333077 NCBI
- BioCyc:
- MicrobesOnline: 3707636 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGTAATCAACAAGATGTTGTAAAAGAATTGAATCAACAAGTAGCAAACTGGACAGTA
GCTTACACAAAGCTACACAATTTCCACTGGTATGTGAAAGGGCCTAACTTCTTCTCATTA
CACGTTAAATTTGAAGAATTATATAATGAAGCAAGCCAATATGTAGACGAATTAGCTGAA
AGAATTTTAGCGGTAGGAGGAAACCCTGTAGGTACATTAACTGAATGCTTAGAGCAATCA
ATTGTTAAAGAAGCTGCGAAAGGTTACTCTGCAGAACAAATGGTTGAAGAATTATCACAA
GACTTCACAAATATCTCAAAACAATTAGAAAACGCAATCGAAATTGCTGGTAATGCTGGC
GATGATGTATCAGAAGATATGTTTATAGGTATGCAAACATCAGTAGATAAACATAATTGG
ATGTTTAAATCTTACTTAAGCTAA60
120
180
240
300
360
420
444
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2043 [new locus tag: NWMN_RS11800 ]
- symbol: NWMN_2043
- description: hypothetical protein
- length: 147
- theoretical pI: 4.29468
- theoretical MW: 16691.5
- GRAVY: -0.394558
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds bacterioferritin (TIGR00754; HMM-score: 17.9)
- TheSEED :
- DNA protection during starvation protein
and 2 more - PFAM: Ferritin (CL0044) Ferritin; Ferritin-like domain (PF00210; HMM-score: 113.2)and 9 moreno clan defined DUF5856; Family of unknown function (DUF5856) (PF19174; HMM-score: 28.5)E-set (CL0159) Lipase_bact_N; Bacterial virulence factor lipase N-terminal (PF12262; HMM-score: 16)no clan defined AvrM-A; Flax-rust effector AvrM-A (PF18241; HMM-score: 15)DUF4455; Domain of unknown function (DUF4455) (PF14643; HMM-score: 13.3)BST2; Bone marrow stromal antigen 2 (PF16716; HMM-score: 13.3)TPR (CL0020) ARMC9_ARM; LisH domain-containing protein ARMC9, ARM repeats (PF21050; HMM-score: 12.7)no clan defined Rab5-bind; Rabaptin-like protein (PF09311; HMM-score: 12.3)GP68; Gp68-like predicted RNA polymerase component (PF17469; HMM-score: 12.1)ABC_tran_CTD; ABC transporter C-terminal domain (PF16326; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8161
- Cytoplasmic Membrane Score: 0.0039
- Cell wall & surface Score: 0.0017
- Extracellular Score: 0.1783
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004322
- TAT(Tat/SPI): 0.000179
- LIPO(Sec/SPII): 0.000538
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAERILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAGDDVSEDMFIGMQTSVDKHNWMFKSYLS
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: PerR* (repression) regulon
PerR* (TF) important in Oxidative stress response; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]