From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002100 [new locus tag: EGJ38_RS10485 ]
  • pan locus tag?: SAUPAN005436000
  • symbol: dps
  • pan gene symbol?: dps
  • synonym:
  • alternate name: JSNZ_002100
  • product: Dps family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002100 [new locus tag: EGJ38_RS10485 ]
  • symbol: dps
  • product: Dps family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2112235..2112678
  • length: 444
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424001 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGTAATCAACAAGATGTTGTAAAAGAATTGAATCAACAAGTAGCAAACTGGACAGTA
    GCTTACACAAAGCTACATAATTTCCACTGGTATGTGAAAGGACCTAACTTCTTCTCATTA
    CACGTTAAATTTGAAGAATTATATAATGAAGCAAGCCAATATGTAGACGAATTAGCTGAA
    AGAATTTTAGCGGTAGGAGGAAACCCTGTAGGTACATTAACTGAATGCTTAGAGCAATCA
    ATTGTTAAAGAAGCTGCGAAAGGTTACTCTGCAGAACAAATGGTTGAAGAATTATCACAA
    GACTTCACAAATATCTCAAAACAATTAGAAAACGCAATCGAAATTGCTGGTAATGCTGGC
    GATGATGTATCAGAAGATATGTTTATAGGTATGCAAACATCAGTAGATAAACATAATTGG
    ATGTTTAAATCTTACTTAAGCTAA
    60
    120
    180
    240
    300
    360
    420
    444

Protein[edit | edit source]

Protein Data Bank: 2D5K

General[edit | edit source]

  • locus tag: EGJ38_002100 [new locus tag: EGJ38_RS10485 ]
  • symbol: Dps
  • description: Dps family protein
  • length: 147
  • theoretical pI: 4.29468
  • theoretical MW: 16691.5
  • GRAVY: -0.394558

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds bacterioferritin (TIGR00754; HMM-score: 17.9)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Ferritin (CL0044) Ferritin; Ferritin-like domain (PF00210; HMM-score: 113.2)
    and 9 more
    no clan defined DUF5856; Family of unknown function (DUF5856) (PF19174; HMM-score: 28.5)
    E-set (CL0159) Lipase_bact_N; Bacterial virulence factor lipase N-terminal (PF12262; HMM-score: 16)
    no clan defined AvrM-A; Flax-rust effector AvrM-A (PF18241; HMM-score: 15)
    DUF4455; Domain of unknown function (DUF4455) (PF14643; HMM-score: 13.3)
    BST2; Bone marrow stromal antigen 2 (PF16716; HMM-score: 13.3)
    TPR (CL0020) ARMC9_ARM; LisH domain-containing protein ARMC9, ARM repeats (PF21050; HMM-score: 12.7)
    no clan defined Rab5-bind; Rabaptin-like protein (PF09311; HMM-score: 12.3)
    GP68; Gp68-like predicted RNA polymerase component (PF17469; HMM-score: 12.1)
    ABC_tran_CTD; ABC transporter C-terminal domain (PF16326; HMM-score: 11.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8161
    • Cytoplasmic Membrane Score: 0.0039
    • Cell wall & surface Score: 0.0017
    • Extracellular Score: 0.1783
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004322
    • TAT(Tat/SPI): 0.000179
    • LIPO(Sec/SPII): 0.000538
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424001 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSNQQDVVKELNQQVANWTVAYTKLHNFHWYVKGPNFFSLHVKFEELYNEASQYVDELAERILAVGGNPVGTLTECLEQSIVKEAAKGYSAEQMVEELSQDFTNISKQLENAIEIAGNAGDDVSEDMFIGMQTSVDKHNWMFKSYLS

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: PerR (repression) regulon
    PerR(TF)important in Oxidative stress response;  regulation predicted or transferred from N315 and NCTC 8325  [1]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]