From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001889 [new locus tag: EGJ38_RS09430 ]
  • pan locus tag?: SAUPAN004840000
  • symbol: perR
  • pan gene symbol?: perR
  • synonym:
  • alternate name: JSNZ_001889
  • product: peroxide-responsive transcriptional repressor PerR

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001889 [new locus tag: EGJ38_RS09430 ]
  • symbol: perR
  • product: peroxide-responsive transcriptional repressor PerR
  • replicon: chromosome
  • strand: -
  • coordinates: 1906343..1906789
  • length: 447
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423800 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGTGTTGAAATAGAATCAATTGAACATGAACTAGAAGAATCAATTGCATCATTGCGA
    CAAGCAGGCGTAAGAATTACACCTCAAAGACAAGCAATATTACGTTATTTAATTTCTTCA
    CATACTCATCCAACAGCTGATGAAATTTATCAAGCACTTTCACCTGATTTTCCAAATATA
    AGTGTTGCGACAATATATAATAACTTAAGAGTGTTTAAAGATATTGGAATTGTAAAAGAA
    TTAACATATGGAGACTCATCAAGTCGATTCGACTTTAATACACATAATCATTATCATATT
    ATATGTGAACAATGTGGTAAGATTGTTGATTTTCAATATCCACAGTTAAATGAAATTGAA
    AGATTAGCTCAGCATATGACTGACTTTGACGTAACACATCATCGAATGGAAATTTATGGA
    GTTTGTAAAGAATGCCAAGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    447


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_001889 [new locus tag: EGJ38_RS09430 ]
  • symbol: PerR
  • description: peroxide-responsive transcriptional repressor PerR
  • length: 148
  • theoretical pI: 5.47242
  • theoretical MW: 17183.2
  • GRAVY: -0.421622

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) FUR; Ferric uptake regulator family (PF01475; HMM-score: 132.9)
    and 11 more
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 24.2)
    HTH_11; HTH domain (PF08279; HMM-score: 14.9)
    no clan defined Eplus_motif; E+ motif (PF20430; HMM-score: 14.6)
    HEF_HK; HEF_HK domain (PF19191; HMM-score: 13.7)
    DUF2039; Uncharacterized conserved protein (DUF2039) (PF10217; HMM-score: 13.6)
    E6; Early Protein (E6) (PF00518; HMM-score: 13.2)
    Tbcl_zf (CL0839) zf-dskA_traR; Prokaryotic dksA/traR C4-type zinc finger (PF01258; HMM-score: 13.1)
    no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 13.1)
    HTH (CL0123) HTH_32; Homeodomain-like domain (PF13565; HMM-score: 12.5)
    Zn_Beta_Ribbon (CL0167) Zn_Ribbon_TF; TFIIB zinc-binding (PF08271; HMM-score: 11.8)
    Ribosomal_L37e; Ribosomal protein L37e (PF01907; HMM-score: 10.5)

Structure, modifications & cofactors[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8939
    • Cytoplasmic Membrane Score: 0.0034
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.1025
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009002
    • TAT(Tat/SPI): 0.003688
    • LIPO(Sec/SPII): 0.001527
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423800 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNISVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQHMTDFDVTHHRMEIYGVCKECQDK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: FapR (repression) regulon, PerR (repression) regulon
    FapR(TF)important in Fatty acid biosynthesis;  regulation predicted or transferred from N315 and NCTC 8325  [1]
    PerR(TF)important in Oxidative stress response;  regulation predicted or transferred from N315 and NCTC 8325  [1]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]