Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001889 [new locus tag: EGJ38_RS09430 ]
- pan locus tag?: SAUPAN004840000
- symbol: perR
- pan gene symbol?: perR
- synonym:
- alternate name: JSNZ_001889
- product: peroxide-responsive transcriptional repressor PerR
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001889 [new locus tag: EGJ38_RS09430 ]
- symbol: perR
- product: peroxide-responsive transcriptional repressor PerR
- replicon: chromosome
- strand: -
- coordinates: 1906343..1906789
- length: 447
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423800 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGTGTTGAAATAGAATCAATTGAACATGAACTAGAAGAATCAATTGCATCATTGCGA
CAAGCAGGCGTAAGAATTACACCTCAAAGACAAGCAATATTACGTTATTTAATTTCTTCA
CATACTCATCCAACAGCTGATGAAATTTATCAAGCACTTTCACCTGATTTTCCAAATATA
AGTGTTGCGACAATATATAATAACTTAAGAGTGTTTAAAGATATTGGAATTGTAAAAGAA
TTAACATATGGAGACTCATCAAGTCGATTCGACTTTAATACACATAATCATTATCATATT
ATATGTGAACAATGTGGTAAGATTGTTGATTTTCAATATCCACAGTTAAATGAAATTGAA
AGATTAGCTCAGCATATGACTGACTTTGACGTAACACATCATCGAATGGAAATTTATGGA
GTTTGTAAAGAATGCCAAGATAAATAA60
120
180
240
300
360
420
447
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001889 [new locus tag: EGJ38_RS09430 ]
- symbol: PerR
- description: peroxide-responsive transcriptional repressor PerR
- length: 148
- theoretical pI: 5.47242
- theoretical MW: 17183.2
- GRAVY: -0.421622
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: HTH (CL0123) FUR; Ferric uptake regulator family (PF01475; HMM-score: 132.9)and 11 moreHTH_20; Helix-turn-helix domain (PF12840; HMM-score: 24.2)HTH_11; HTH domain (PF08279; HMM-score: 14.9)no clan defined Eplus_motif; E+ motif (PF20430; HMM-score: 14.6)HEF_HK; HEF_HK domain (PF19191; HMM-score: 13.7)DUF2039; Uncharacterized conserved protein (DUF2039) (PF10217; HMM-score: 13.6)E6; Early Protein (E6) (PF00518; HMM-score: 13.2)Tbcl_zf (CL0839) zf-dskA_traR; Prokaryotic dksA/traR C4-type zinc finger (PF01258; HMM-score: 13.1)no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 13.1)HTH (CL0123) HTH_32; Homeodomain-like domain (PF13565; HMM-score: 12.5)Zn_Beta_Ribbon (CL0167) Zn_Ribbon_TF; TFIIB zinc-binding (PF08271; HMM-score: 11.8)Ribosomal_L37e; Ribosomal protein L37e (PF01907; HMM-score: 10.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors: Hydrogen peroxide; Iron ion (Fe2+) and Manganese ion (Mn2+) act as corepressor
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8939
- Cytoplasmic Membrane Score: 0.0034
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.1025
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009002
- TAT(Tat/SPI): 0.003688
- LIPO(Sec/SPII): 0.001527
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423800 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNISVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQHMTDFDVTHHRMEIYGVCKECQDK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)