From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1919 [new locus tag: SACOL_RS10030 ]
  • pan locus tag?: SAUPAN004840000
  • symbol: SACOL1919
  • pan gene symbol?: perR
  • synonym:
  • product: FUR family transcriptional regulator

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1919 [new locus tag: SACOL_RS10030 ]
  • symbol: SACOL1919
  • product: FUR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 1982818..1983264
  • length: 447
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGTGTTGAAATAGAATCAATTGAACATGAACTAGAAGAATCAATTGCATCATTGCGA
    CAAGCAGGCGTAAGAATTACACCTCAAAGACAAGCAATATTACGTTATTTAATTTCTTCA
    CATACTCATCCAACAGCTGATGAAATTTATCAAGCACTTTCACCTGATTTTCCAAATATA
    AGTGTTGCGACAATATATAATAACTTAAGAGTGTTTAAAGATATTGGAATTGTAAAAGAA
    TTAACATATGGAGACTCATCAAGTCGATTCGACTTTAATACACATAATCATTATCATATT
    ATATGTGAACAATGTGGTAAGATTGTTGATTTTCAATATCCACAGTTAAATGAAATTGAA
    AGATTAGCTCAGCATATGACTGACTTTGACGTAACACATCATCGAATGGAAATTTATGGA
    GTTTGTAAAGAATGCCAAGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    447

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1919 [new locus tag: SACOL_RS10030 ]
  • symbol: SACOL1919
  • description: FUR family transcriptional regulator
  • length: 148
  • theoretical pI: 5.47242
  • theoretical MW: 17183.2
  • GRAVY: -0.421622

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Peroxide stress regulator PerR, FUR family
    Stress Response Oxidative stress Oxidative stress  Peroxide stress regulator PerR, FUR family
  • PFAM:
    HTH (CL0123) FUR; Ferric uptake regulator family (PF01475; HMM-score: 138.1)
    and 11 more
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 17.2)
    no clan defined Type2_restr_D3; Type-2 restriction enzyme D3 domain (PF16902; HMM-score: 16.3)
    SR1P; SR1 protein (PF13790; HMM-score: 14.9)
    C2H2-zf (CL0361) zf-BED; BED zinc finger (PF02892; HMM-score: 13.8)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 13.7)
    no clan defined E6; Early Protein (E6) (PF00518; HMM-score: 13.6)
    DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 12.4)
    Zn_Beta_Ribbon (CL0167) zf-dskA_traR; Prokaryotic dksA/traR C4-type zinc finger (PF01258; HMM-score: 11)
    no clan defined DUF2039; Uncharacterized conserved protein (DUF2039) (PF10217; HMM-score: 10.8)
    Zn_Beta_Ribbon (CL0167) TF_Zn_Ribbon; TFIIB zinc-binding (PF08271; HMM-score: 10.5)
    Ribosomal_L37e; Ribosomal protein L37e (PF01907; HMM-score: 10.4)

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009002
    • TAT(Tat/SPI): 0.003688
    • LIPO(Sec/SPII): 0.001527
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNISVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQHMTDFDVTHHRMEIYGVCKECQDK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 131 [4]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulators: FapR* (repression) regulon, PerR* (repression) regulon
    FapR*(TF)important in Fatty acid biosynthesis; RegPrecise 
    PerR*(TF)important in Oxidative stress response; RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL1919&oldid=92625"