From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000804 [new locus tag: EGJ38_RS04015 ]
  • pan locus tag?: SAUPAN002898000
  • symbol: sufU
  • pan gene symbol?: sufU
  • synonym:
  • alternate name: JSNZ_000804
  • product: Fe-S cluster assembly sulfur transfer protein SufU

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000804 [new locus tag: EGJ38_RS04015 ]
  • symbol: sufU
  • product: Fe-S cluster assembly sulfur transfer protein SufU
  • replicon: chromosome
  • strand: +
  • coordinates: 834598..835062
  • length: 465
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422779 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAATTTTAATAATCTAGATCAATTATATAGATCTGTCATTATGGATCATTATAAAAAT
    CCTAGAAATAAAGGTGTATTAGATAACGGGTCTATGACAGTAGATATGAATAACCCGACA
    TGCGGTGACCGTATACGACTAACATTTGATATAGAAGACGGCATTATAAAAGATGCTAAG
    TTTGAAGGTGAAGGTTGTTCGATTTCAATGGCAAGTGCATCGATGATGACACAAGCTGTT
    AAAGGTCATTCACTTGGAGAAGCAATGCAAATGAGCCAAGAATTTACGAAAATGATGCTT
    GGTGAAGACTATGTGATTACAGAAGAAATGGGAGATATTGAAGCATTGCAAGGTGTATCT
    CAATTCCCAGCTCGTATTAAATGTGCCACATTAGCTTGGAAAGCATTGGAAAAAGGTACT
    GTTGCTAAAGAAGGTAAAGCAGAAGGTACGACTGAAGAAGAATAG
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000804 [new locus tag: EGJ38_RS04015 ]
  • symbol: SufU
  • description: Fe-S cluster assembly sulfur transfer protein SufU
  • length: 154
  • theoretical pI: 4.4445
  • theoretical MW: 17016.3
  • GRAVY: -0.43961

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other SUF system FeS assembly protein, NifU family (TIGR01994; HMM-score: 184.2)
    and 6 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS cluster assembly scaffold protein NifU (TIGR03419; HMM-score: 88.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS cluster assembly scaffold IscU (TIGR01999; HMM-score: 73.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)
    Metabolism Central intermediary metabolism Nitrogen fixation Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 58.4)
    soluble methane monooxygenase-binding protein MmoD (TIGR04550; HMM-score: 13.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (TIGR00097; EC 2.7.1.49,2.7.4.7; HMM-score: 13.7)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    SufE_NifU (CL0233) NifU_N; NifU-like N terminal domain (PF01592; HMM-score: 122.9)
    and 3 more
    Ribokinase (CL0118) Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 16.2)
    no clan defined TSCPD; TSCPD domain (PF12637; HMM-score: 14.3)
    SufE_NifU (CL0233) Lip_prot_lig_C; Bacterial lipoate protein ligase C-terminus (PF10437; HMM-score: 13.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9843
    • Cytoplasmic Membrane Score: 0.0009
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0148
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012339
    • TAT(Tat/SPI): 0.000348
    • LIPO(Sec/SPII): 0.001049
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422779 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNFNNLDQLYRSVIMDHYKNPRNKGVLDNGSMTVDMNNPTCGDRIRLTFDIEDGIIKDAKFEGEGCSISMASASMMTQAVKGHSLGEAMQMSQEFTKMMLGEDYVITEEMGDIEALQGVSQFPARIKCATLAWKALEKGTVAKEGKAEGTTEEE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: PerR (repression) regulon
    PerR(TF)important in Oxidative stress response;  regulation predicted or transferred from N315 and NCTC 8325  [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]