Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2109 [new locus tag: NWMN_RS12205 ]
- pan locus tag?: SAUPAN005623000
- symbol: NWMN_2109
- pan gene symbol?: —
- synonym:
- product: truncated MHC class II analog protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2109 [new locus tag: NWMN_RS12205 ]
- symbol: NWMN_2109
- product: truncated MHC class II analog protein
- replicon: chromosome
- strand: +
- coordinates: 2347265..2347690
- length: 426
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331292 NCBI
- RefSeq: YP_001333143 NCBI
- BioCyc:
- MicrobesOnline: 3707711 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAACTAAAATCATTTGTTACTGCCACTTTAGCATTGGGATTATTATCAACGGTCGGA
GCTGCATTACCGAGTCACGAAGCATCTGCAGATAGTAATAACGGCTATAAAGAAATGACT
GTGGATGGTTATCACACTGTTCCTTACACAATTTCAGTAGATGGTATTACTGCATTACAT
CGAACTTACTTTATCTTCCCAGAAAATAAAAATGTTCTTTATCAAGAAATTGACAGTAAA
GTAAAAAATGAATTAGCTTCTCAACGTGGTGTTACAACAGAAAAAATTAATAATGCCCAA
ACAGCAACTTATACGCTTACTTTGAATGATGGTAATAAAAAAGTAGTGAATCTAAAGAAA
AATGACGACGCTAAAAATTCAATTGATCCAAGTACAATCAAACAGATACAAATTGTAGTT
AAATAA60
120
180
240
300
360
420
426
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2109 [new locus tag: NWMN_RS12205 ]
- symbol: NWMN_2109
- description: truncated MHC class II analog protein
- length: 141
- theoretical pI: 9.27199
- theoretical MW: 15447.4
- GRAVY: -0.34539
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Truncated cell surface protein map-w
- PFAM: no clan defined MAP; MAP domain (PF03642; HMM-score: 120.1)and 2 moreUbiquitin (CL0072) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 22.3)no clan defined YHR052C-B; YHR052C-B (PF23530; HMM-score: 16.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 9.68
- Cellwall Score: 0.17
- Extracellular Score: 0.16
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0012
- Cell wall & surface Score: 0.0131
- Extracellular Score: 0.9856
- LocateP: Secretory(released) (with CS)
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: -0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: HEASADSN
- SignalP: Signal peptide SP(Sec/SPI) length 30 aa
- SP(Sec/SPI): 0.99281
- TAT(Tat/SPI): 0.005319
- LIPO(Sec/SPII): 0.001605
- Cleavage Site: CS pos: 30-31. ASA-DS. Pr: 0.9287
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLKSFVTATLALGLLSTVGAALPSHEASADSNNGYKEMTVDGYHTVPYTISVDGITALHRTYFIFPENKNVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)