Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2177 [new locus tag: NWMN_RS12580 ]
- pan locus tag?: SAUPAN005738000
- symbol: modC
- pan gene symbol?: modC
- synonym:
- product: molybdenum ABC transporter ATP-binding protein ModC
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2177 [new locus tag: NWMN_RS12580 ]
- symbol: modC
- product: molybdenum ABC transporter ATP-binding protein ModC
- replicon: chromosome
- strand: -
- coordinates: 2400130..2400735
- length: 606
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332160 NCBI
- RefSeq: YP_001333211 NCBI
- BioCyc:
- MicrobesOnline: 3707779 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGCTTAAAATCAATGTGAAATATCAATTAAAGAACACTTTAATTCGCATCAATATAGAT
GATACTGAACCAAAAATTTATGCAGTTCGTGGTCCATCTGGCATTGGTAAAACTACTGTT
TTAAATATGATTGCCGGATTACGTAAAGCAGATGAAGCTATTATCGAAGTGAATGGGCAA
TTACTTACTGATACGGCAAAAAACGTGAATGTTAAAATTCAACAACGACGTATTGGATAT
CTGTTTCAAGACTACCAATTGTTTCCTAATATGACGGTCTATAAAAATATTACTTTTATG
GCTGAACCATCTGAACACATCGATCAATTAATTCAAACTTTAAACATTGATCATTTGATG
AAACAATATCCTATGACATTGTCAGGTGGAGAGGCACAACGTGTAGCACTTGCACGTGCA
CTTAGCACGAAACCAGATTTAATTTTATTAGATGAACCTTTTTCTAGTTTGGATGATACT
ACAAAAGATGAGAGTATTACATTAGTTAAACGTATTTTCAACGAATGGCAAATACCAATC
ATATTTGTGACACATTCAAACTATGAAGCAGAACAAATGGCTCATGAAATTATTACAATT
GGGTAA60
120
180
240
300
360
420
480
540
600
606
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2177 [new locus tag: NWMN_RS12580 ]
- symbol: ModC
- description: molybdenum ABC transporter ATP-binding protein ModC
- length: 201
- theoretical pI: 6.12305
- theoretical MW: 22877.3
- GRAVY: -0.168159
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 195.5)and 74 moreTransport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 151.4)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 148.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 146.8)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 146.8)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 136)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 133.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 129.6)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 128.4)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 120)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 119.6)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 114.8)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 114.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 111.9)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 105)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 104.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 103.9)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 103.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 103.7)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 103.7)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 98.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 98.2)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 96.6)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 93.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 92.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 89)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 87.1)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 80.7)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 79.9)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 79.7)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 79.7)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 77.8)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 76.6)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 76.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 74.7)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 74.5)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 73.7)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 73.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 73.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 73.1)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 73)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 71.6)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 70.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 67.9)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 64.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 60.9)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 60.9)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 59)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 59)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 59)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 54.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 54.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 53.7)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 53.7)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 50)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 50)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 48.6)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 46.4)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 46.4)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 44.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 43.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 42.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 41.2)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 37.8)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 34)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 33)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 27.1)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 25.7)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 25.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 23.7)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 23.3)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 23.2)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 14.9)flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 12.7)Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 11.9)
- TheSEED :
- Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113.1)and 20 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 23.5)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 23)AAA_22; AAA domain (PF13401; HMM-score: 22.7)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 19.5)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 18.2)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 18.2)AAA_14; AAA domain (PF13173; HMM-score: 18)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.9)TniB; Bacterial TniB protein (PF05621; HMM-score: 17.5)NTPase_1; NTPase (PF03266; HMM-score: 16)no clan defined RseA_C; Anti sigma-E protein RseA, C-terminal domain (PF03873; HMM-score: 16)P-loop_NTPase (CL0023) AAA_16; AAA ATPase domain (PF13191; HMM-score: 15.9)NB-ARC; NB-ARC domain (PF00931; HMM-score: 14.3)AAA_19; AAA domain (PF13245; HMM-score: 14.1)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 14)AAA_30; AAA domain (PF13604; HMM-score: 14)AAA_24; AAA domain (PF13479; HMM-score: 13.3)CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 13.1)P-loop_NTPase (CL0023) NACHT; NACHT domain (PF05729; HMM-score: 12.4)AAA_13; AAA domain (PF13166; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 9.99
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.3383
- Cytoplasmic Membrane Score: 0.6546
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0067
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006389
- TAT(Tat/SPI): 0.00023
- LIPO(Sec/SPII): 0.000448
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKINVKYQLKNTLIRINIDDTEPKIYAVRGPSGIGKTTVLNMIAGLRKADEAIIEVNGQLLTDTAKNVNVKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPSEHIDQLIQTLNIDHLMKQYPMTLSGGEAQRVALARALSTKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQIPIIFVTHSNYEAEQMAHEIITIG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
NWMN_1605 (ackA) acetate kinase [1] (data from MRSA252) NWMN_0113 (aldA) aldehyde dehydrogenase-like protein [1] (data from MRSA252) NWMN_1587 (citC) isocitrate dehydrogenase [1] (data from MRSA252) NWMN_1483 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) NWMN_1096 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) NWMN_0509 (fus) elongation factor G [1] (data from MRSA252) NWMN_1837 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [1] (data from MRSA252) NWMN_0961 (pdhC) branched-chain alpha-keto acid dehydrogenase subunit E2 [1] (data from MRSA252) NWMN_0962 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) NWMN_0959 (phdA) pyruvate dehydrogenase E1 component, alpha subunit [1] (data from MRSA252) NWMN_0960 (phdB) pyruvate dehydrogenase E1 component, beta subunit [1] (data from MRSA252) NWMN_2438 (poxB) pyruvate oxidase [1] (data from MRSA252) NWMN_1592 (pykA) pyruvate kinase [1] (data from MRSA252) NWMN_0500 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_2149 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) NWMN_2137 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) NWMN_1151 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_1549 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_1166 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) NWMN_2146 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_2135 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) NWMN_0055 (spa) immunoglobulin G binding protein A precursor (protein A) [1] (data from MRSA252) NWMN_1326 (sucA) 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) NWMN_1325 (sucB) dihydrolipoamide succinyltransferase [1] (data from MRSA252) NWMN_0510 (tufA) elongation factor Tu [1] (data from MRSA252) NWMN_1604 universal stress protein family protein [1] (data from MRSA252) NWMN_2086 alkaline shock protein 23 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: modC < modB < modA
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)