From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2299 [new locus tag: NWMN_RS13220 ]
  • pan locus tag?: SAUPAN005931000
  • symbol: nirD
  • pan gene symbol?: nasE
  • synonym:
  • product: assimilatory nitrite reductase [NAD(P)H], small subunit

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2299 [new locus tag: NWMN_RS13220 ]
  • symbol: nirD
  • product: assimilatory nitrite reductase [NAD(P)H], small subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 2526690..2527004
  • length: 315
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGAAACAAAAGAAAAAATTAAAGTGACAACTATAGATGAATTAACACCCCTAATTGGA
    AAAAAGGTTATTGTCAAAGGCAAAGAGGTAGGGTTGTTTTTAACAGAAAGTGGCAAAATT
    CATGCGATTCACAATATCTGTCCACACAAACAAGGACCATTGTCTGAAGGGACAGTGAGT
    GGGGAATATGTATTTTGCCCGCTCCACGATCAAAAAATTGATTTAAATACAGGTATTGTT
    CAAGAACCTGATGAAGGTTGTGTAGATGTTTATGAGGTAGAAGTTACAGACGGGAACGTA
    TATATATGTCTGTAG
    60
    120
    180
    240
    300
    315

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2299 [new locus tag: NWMN_RS13220 ]
  • symbol: NirD
  • description: assimilatory nitrite reductase [NAD(P)H], small subunit
  • length: 104
  • theoretical pI: 4.70663
  • theoretical MW: 11437.1
  • GRAVY: -0.106731

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrite reductase [NAD(P)H], small subunit (TIGR02378; EC 1.7.1.4; HMM-score: 82.3)
    and 1 more
    Rieske [2Fe-2S] domain protein, MocE subfamily (TIGR02377; HMM-score: 35.7)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    ISP-domain (CL0516) Rieske_2; Rieske-like [2Fe-2S] domain (PF13806; HMM-score: 65.1)
    and 1 more
    Rieske; Rieske [2Fe-2S] domain (PF00355; HMM-score: 43)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011677
    • TAT(Tat/SPI): 0.000435
    • LIPO(Sec/SPII): 0.000882
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGKIHAIHNICPHKQGPLSEGTVSGEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: Rex* (repression) regulon, NreC* (activation) regulon
    Rex*(TF)important in Energy metabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise 
    NreC*(TF)important in Nitrate and nitrite respiration; RegPrecise    transcription unit transferred from N315 data RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]